Recombinant Chicken Protein wntless homolog(WLS)

Code CSB-CF736602CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5ZLR1
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence VPYMSVKCIDVRKNHHKTKWLMPWGPNHCEKLKDFDEAVSRQIEANDIVFAVHIPLPSKE MSPWFQFMLFIMQLDIAFKMDNDLKENAEITLDVSLAYRDDMFNDWEEIAHAIEIRKLKC TFGSPKTLESEGRHYDCDFLPFMEIGSVAHKYYLINIRLPVNERKGINVGIGEVKDIRLV GIHQNGGFTKVWFAMKTFLTPSILIIMVWYWRRITLMTRAPVLLEKVIFALGISMTFINI PVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQNERNRLSGYWKQVGPI AVGSFCLFIFDMCERGVQLKNPFYSIWTTEVGTELAMAFIIVAGICLCLYFLFLCFMVFQ VFRNISGKQSSLPAMSKARRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKW GDITIQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGDLGVSSGEELQLTTTI THVDGPTEVYKLARKEAQE
Source in vitro E.coli expression system
Gene Names WLS
Protein Names Recommended name: Protein wntless homolog Alternative name(s): Integral membrane protein GPR177
Expression Region 43-541
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play an essential role in Wnt signaling pathway. May be required for Wnt-dependent patterning processes (By similarity).
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein
Protein Families Wntless family
Database Links

KEGG: gga:424707

STRING: 9031.ENSGALP00000018306

UniGene: Gga.1785

Related Products

WLS Proteins

WLS Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.