Recombinant Chlorocebus aethiops CD209 antigen(CD209)

Code CSB-CF004899DSU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P60883
Storage Buffer Tris-based buffer,50% glycerol
Species Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Sequence MSDSKEPRLQQLGLLEEEQLGGVGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSLSQGQSKQDAIYQNLTQLKVAVSELSEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSQLKAAVGDLPEKSKQQEIYQKLTQLKAAVDGLPDRSKQQEIYQELIQLKAAVERLCRPCPWEWTFFQGNCYFMSNSQRNWHNSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNIGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPTPTTPNPPPE
Source in vitro E.coli expression system
Gene Names CD209
Protein Names Recommended name: CD209 antigen Alternative name(s): Dendritic cell-specific ICAM-3-grabbing non-integrin 1 Short name= DC-SIGN1 CD_antigen= CD209
Expression Region 1-381
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens (By similarity).
Subcellular Location Membrane, Single-pass type II membrane protein
Tissue Specificity Expressed in lymph nodes.

Related Products

CD209 Proteins

CD209 Proteins for Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.