Recombinant Coturnix coturnix japonica Endothelin B receptor(EDNRB)

Code CSB-CF856176DXJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q90328
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
Sequence EIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIID IPISVYKLLAEDWPFGVEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGV PKWTAVEIVLIWVISVVLAVPEAIAFDMITMEYRGKDLRICLLHPTQKTSFMMFYKQAKD WWLFSFYFCLPLAITALFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFAL CWLPLHLSRILKLTIYDQKDPNRCELLSFFLVMDYIGINMASLNSCINPIALYLVSKRFQ NCFKSCLCCWCQSKDLLSLEERQSCLKFKANDHGYDNFRSSNKYSSS
Source in vitro E.coli expression system
Gene Names EDNRB
Protein Names Recommended name: Endothelin B receptor Short name= ET-B Short name= ET-BR Alternative name(s): Endothelin receptor non-selective type
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Non-specific receptor for endothelin 1, 2, and 3. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRB sub-subfamily
Pathway Calcium signaling pathway
Melanogenesis
cGMP-PKG signaling pathway

Related Products

EDNRB Proteins

EDNRB Proteins for Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.