Recombinant Danio rerio Vang-like protein 2(vangl2)

Code CSB-CF837677DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8UVJ6
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MDNESQYSGYSYKSSHSRSSRKHRDRRDRHRSKSRDSSSRGDKSVTIQAPGEPLLDAEST RGDDRDDNWGETTTVVTGTSEHSVSNEDLTRASKELEDSSPLECRRFAGPIVSGVLGLFA LLTPLAFLLLPQLLWRDSLEPCGTPCEGLYVSLAFKLLVLLISSWALFLRPSRSTLPRFF VFRCLLMALVFLFVASYWLFYGVRVLEPRERDYRGIVGYAVSLVDALLFIQYLALVLLEV RHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNPALLNLPKSILS KKMSGFKVYSLGEENSTNNSTGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRVRKRKARL VVAVEEAFTHIKRLQDDEAAASPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYH SMESIISHLQFCITHNMTPKAFLERYLTPGPTMQYQRENGRGRQWTLVSEEPVTAALRQG LVFSLRRLDFALVVTVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV
Source in vitro E.coli expression system
Gene Names vangl2
Protein Names Recommended name: Vang-like protein 2 Alternative name(s): Protein strabismus Protein trilobite Van Gogh-like protein 2
Expression Region 1-526
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in non-canonical Wnt/planar cell polarity (PCP) signaling to regulate convergent extension cell movements during gastrulation. Acts together with scrib and prickle1 and localizes prickle1 and dvl2/dsh to the plasma membrane. Has an overlapping role with kny during both convergent extension and eye development. In the eye, involved in establishing proper alignment of the anterior neural plate and midline cells expressing shha and shhb/twhh. Has indirect effects on a number of other developmental processes including notochord shape formation, neural progenitor cell morphogenesis, segregation of somites and adaxial cell development. Together with prickle1, required for the posterior (caudal) movement of branchiomotor neurons in the hindbrain independently of, and a few hours after, convergent extension
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Vang family
Tissue Specificity Ubiquitously expressed at the 4-cell stage. In early somitogenesis, becomes more abundant in anterior neural tissue where expression is seen in the neural tube but not in the notochord.
Database Links

KEGG: dre:245949

STRING: 7955.ENSDARP00000031546

UniGene: Dr.91583

Pathway Wnt signaling pathway

Related Products

vangl2 Antibodies

vangl2 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

vangl2 Proteins

vangl2 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.