Recombinant Danio rerio Vang-like protein 2 (vangl2)

Code CSB-CF837677DIL
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
vangl2
Uniprot No.
Alternative Names
vangl2; stbm; tri; Vang-like protein 2; Protein strabismus; Protein trilobite; Van Gogh-like protein 2
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Region
1-526
Target Protein Sequence
MDNESQYSGYSYKSSHSRSSRKHRDRRDRHRSKSRDSSSRGDKSVTIQAPGEPLLDAEST RGDDRDDNWGETTTVVTGTSEHSVSNEDLTRASKELEDSSPLECRRFAGPIVSGVLGLFA LLTPLAFLLLPQLLWRDSLEPCGTPCEGLYVSLAFKLLVLLISSWALFLRPSRSTLPRFF VFRCLLMALVFLFVASYWLFYGVRVLEPRERDYRGIVGYAVSLVDALLFIQYLALVLLEV RHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNPALLNLPKSILS KKMSGFKVYSLGEENSTNNSTGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRVRKRKARL VVAVEEAFTHIKRLQDDEAAASPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYH SMESIISHLQFCITHNMTPKAFLERYLTPGPTMQYQRENGRGRQWTLVSEEPVTAALRQG LVFSLRRLDFALVVTVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in non-canonical Wnt/planar cell polarity (PCP) signaling to regulate convergent extension cell movements during gastrulation. Acts together with scrib and prickle1 and localizes prickle1 and dvl2/dsh to the plasma membrane. Has an overlapping role with kny during both convergent extension and eye development. In the eye, involved in establishing proper alignment of the anterior neural plate and midline cells expressing shha and shhb/twhh. Has indirect effects on a number of other developmental processes including notochord shape formation, neural progenitor cell morphogenesis, segregation of somites and adaxial cell development. Together with prickle1, required for the posterior (caudal) movement of branchiomotor neurons in the hindbrain independently of, and a few hours after, convergent extension. May be required for cell surface localization of fzd3 and fzd6 in the inner ear.
Gene References into Functions
  1. Results demonstrate that anterior guidance decisions by commissural primary ascending (CoPA) axons are dependent on the function of planar cell polarity genes Fzd3a, Vangl2 and Scribble both prior to and after midline crossing; experiments establish CoPA axons as a model system to investigate the mechanism of planar cell polarity signaling in commissural axon guidance. PMID: 27955617
  2. dynamic Vangl2 intracellular distribution is coordinated with and necessary for the changes in convergence and extension cell behaviors during gastrulation PMID: 26062934
  3. we found that the critical period for Vangl2 function coincides with the initial stages of FBM neuron migration out of rhombomere 4. PMID: 24333599
  4. Vangl2 regulates FBM neuron migration by acting in floor plate cells, independently of cilia function PMID: 23988578
  5. VANGL2 regulates the endocytosis and cell-surface availability of MMP14 in a manner that is dependent on focal adhesion kinase. PMID: 22357946
  6. Vangl2(R259L) behaved like the wild-type allele in overexpression and morpholino knockdown/rescue assays in zebrafish embryos. PMID: 21404367
  7. data suggest that bbs8 and vangl2 act synergistically on cell polarization to establish and maintain the appropriate length and number of cilia in the Kupffer's vesicle and thereby facilitate correct LR asymmetry PMID: 20643117
  8. Vangl2 is required for asymmetric localization and posterior tilting of primary motile cilia at the apical membrane of epithelial cells. PMID: 20305649
  9. show that anterior hindbrain (r2/r3) motor neuron migration appears to be independent of vangl2 and pk1b functions, and suggest that multiple mechanisms regulate motor neuron migration along the anterior-posterior axis of the zebrafish hindbrain PMID: 19937772
  10. The vangl2 gene product mediates cellular interactions that confer directionality on distinct movements during vertebrate embryogenesis. PMID: 12105418

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Vang family
Tissue Specificity
Ubiquitously expressed at the 4-cell stage. In early somitogenesis, becomes more abundant in anterior neural tissue where expression is seen in the neural tube but not in the notochord.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1