Recombinant Dopamine receptor 3(dop-3)

Code CSB-CF740853CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6RYS9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Caenorhabditis elegans
Sequence MLAGQHHVTDIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLI VSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDLQECELANPYF NMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQ MGKHFKNRTDQILLEISFQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPA IPECGSMPNLTIIERPEAEKEKEISIMDLRDTVEMLDDKYSSAILTSFQTSRSFGEELEE ILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDEKKLSQKSNDLPF SHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSD SMRVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLP FFVLHLSNSICLIIDENSACVGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILS CGIFKKR
Source in vitro E.coli expression system
Gene Names dop-3
Protein Names Recommended name: Dopamine receptor 3
Expression Region 1-607
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. In terms of antagonist responses, would be classed with the D2-like dopamine receptor group. Mediates the effect of dopamine on the inhibition of locomotion. Acts as an antagonist of dop-1.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in the neurons of the head, ventral cord and tail with weak expression observed in body wall muscles and PVD neurons. In the ventral cord, expressed strongly in GABAergic neurons with weaker expression in cholinergic motor neurons.
Database Links

KEGG: cel:CELE_T14E8.3

STRING: 6239.T14E8.3b

UniGene: Cel.355

Related Products

dop-3 Antibodies

dop-3 Antibodies for Caenorhabditis elegans

dop-3 Proteins

dop-3 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.