Recombinant Dopamine receptor 3 (dop-3)

Code CSB-CF740853CXY
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
dop-3
Uniprot No.
Alternative Names
dop-3; T14E8.3; Dopamine receptor 3; Dopamine D2-like receptor dop-3
Species
Caenorhabditis elegans
Expression Region
1-607
Target Protein Sequence
MLAGQHHVTDIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLI VSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDLQECELANPYF NMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQ MGKHFKNRTDQILLEISFQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPA IPECGSMPNLTIIERPEAEKEKEISIMDLRDTVEMLDDKYSSAILTSFQTSRSFGEELEE ILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDEKKLSQKSNDLPF SHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSD SMRVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLP FFVLHLSNSICLIIDENSACVGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILS CGIFKKR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor which binds to the neurotransmitter dopamine with high affinity leading to the activation of an associated G-protein and downstream signaling pathways. Couples to G-proteins to inhibit adenylate cyclase (AC) activity and cAMP production. Antagonizes the D1-like dopamine receptor dop-1 to negatively regulate the rate of locomotion. In GABAergic, RIC, and SIA neurons, antagonizes the function of dop-1 to play a role in behavioral plasticity and regulate the decision-making process when conflicting alternatives are present. Antagonizes octopamine signaling in response to food by promoting the dopamine-mediated suppression of crh-1/CREB1 transcription factor activation in cholinergic SIA neurons. This is most likely in association with the G(o) alpha G-protein subunit goa-1. Promotes male mating behavior by antagonizing acetylcholine signaling to control the protrusion of copulatory spicules from the tail of males during hermaphrodite vulval location.
Gene References into Functions
  1. We demonstrate that dopamine, through DOP-3, negatively regulates NCA activity. PMID: 28968387
  2. dopaminergic signaling through DOP-3 normally acts to dampen ASH signaling and behavioral sensitivity to octanol PMID: 20209143
  3. Enhancement of odor avoidance learning requires dopamine signaling via dopamine receptor DOP-3. PMID: 21123582
  4. DOP-3 attenuates forskolin-stimulated cAMP formation in response to dopamine stimulation, whereas DOP-3nf does not. When DOP-3 was coexpressed with DOP-3nf, the ability to inhibit forskolin-stimulated cAMP formation was reduced. PMID: 16001968
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the neurons of the head, ventral cord and tail with weak expression observed in body wall muscles and PVD neurons. In the ventral cord, expressed strongly in GABAergic neurons with weaker expression in cholinergic motor neurons. Expressed in
Database Links

KEGG: cel:CELE_T14E8.3

STRING: 6239.T14E8.3b

UniGene: Cel.355

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×