Recombinant Dopamine receptor 4 (dop-4)

Code CSB-CF615124CXY
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
dop-4
Uniprot No.
Alternative Names
dop-4; C52B11.3; Dopamine receptor 4
Species
Caenorhabditis elegans
Expression Region
1-517
Target Protein Sequence
MLAYGSDPNAEDLYITMTPSVSTENDTTVWATEEPAAIVWRHPLLAIALFSICLLTVAGN CLVVIAVCTKKYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFH AMDILASTASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGII WWRTSSPHLYEDQSQCLFTDSKMYVSFSSLVSFYIPLFLILFAYGKVYIIATRHSKGMRM GIKTVSIKKRNGKKSNTETESILSSENEPTLRIHFGRGKQSSSSLRNSRFHARESTRLLL KQVSCKSLNDRGEHNNNNTVRQPLLRGTEGCHSDSISRSSQRNFRGRNVTIGSNCSSTLL QVDQPDRMSLSSNSQMVMTSPLSTRRKLNVREKSRQMMRYVHEQRAARTLSIVVGAFILC WTPFFVFTPLTAFCESCFSNKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQILTC QRQQKVKTAFKTPLSLVFTQLISVTQMWEQPPNTSIE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. In terms of antagonist responses, would be classed with the D1-like dopamine receptor group.
Gene References into Functions
  1. Study established a high-throughput learning assay that used real-time computer vision software for behavioral tracking and optogenetics for stimulation of the C. elegans polymodal nociceptor, ASH. Food and dopamine signaling slowed habituation downstream from ASH excitation via D1-like dopamine receptor, DOP-4. Assay allows for large-scale genetic and drug screens investigating mechanisms of nociception modulation. PMID: 27634141
  2. DOP-4 shows high sequence homology with D1-like dopamine receptors unique to invertebrates, distinct from mammalian D1-like dopamine receptors. Reporter gene assay showed that DOP-4 stimulates cAMP accumulation in response to dopamine stimulation. PMID: 16001968
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in pharyngeal neurons I1 and I2, neurons ASG, AVL, CAN, PQR, vulva, intestine, rectal glands and rectal epithelial glands. Also expressed in neurons in ray 8 in males.
Database Links

KEGG: cel:CELE_C52B11.3

STRING: 6239.C52B11.3

UniGene: Cel.26174

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1