Recombinant Drosophila grimshawi Protein wntless(wls)

Code CSB-CF459614DLL
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names wls
Uniprot No. B4J2W3
Alternative Names
wls; GH16661; Protein wntless
Species Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Expression Region 36-562
Target Protein Sequence APVPAGHQTVLGSKCRDVPGRQNDTSFFLYSRGNGACKSLQDIDIEQDELKMANQLVYVF QMPLPRDNNTLQYSRWQQNLIGVLQVDIAYDSASELREPPKELQLTIDTRLAYRNQKDAD TDWKLYAHSVEQRYLDCHASHVGRLETLYTCDIIPLFELGALHHNFYLLNLRFPMDTPKQ MNLQFGHMHDLTLTAIHQNGGFTQVWLVLKTLLFPFVIGIMMWFWRRVHILQRSPALLEY MLFYLGGALSFLNLPLELLTLGVEMPYMLLLSDVRQGIFYAMLLSFWLVFAGEHMLIQDS PSKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQMRNPFYSIWTTPLGAKVAMSFIVLA GVSAAIYFLFLCFMVWKVFKDIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAGL TVAGFIMGQMAEGHWKWNENIEIQLTSAFLTGVYGMWNIYIFALIILYAPSHKQWPTMRH SDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFD
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip.
Subcellular Location Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Protein Families Wntless family
Database Links

KEGG: dgr:Dgri_GH16661

STRING: 7222.FBpp0150567

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1