Recombinant Drosophila grimshawi Protein wntless(wls)

Code CSB-CF459614DLL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B4J2W3
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Sequence APVPAGHQTVLGSKCRDVPGRQNDTSFFLYSRGNGACKSLQDIDIEQDELKMANQLVYVF QMPLPRDNNTLQYSRWQQNLIGVLQVDIAYDSASELREPPKELQLTIDTRLAYRNQKDAD TDWKLYAHSVEQRYLDCHASHVGRLETLYTCDIIPLFELGALHHNFYLLNLRFPMDTPKQ MNLQFGHMHDLTLTAIHQNGGFTQVWLVLKTLLFPFVIGIMMWFWRRVHILQRSPALLEY MLFYLGGALSFLNLPLELLTLGVEMPYMLLLSDVRQGIFYAMLLSFWLVFAGEHMLIQDS PSKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQMRNPFYSIWTTPLGAKVAMSFIVLA GVSAAIYFLFLCFMVWKVFKDIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAGL TVAGFIMGQMAEGHWKWNENIEIQLTSAFLTGVYGMWNIYIFALIILYAPSHKQWPTMRH SDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFD
Source in vitro E.coli expression system
Gene Names wls
Protein Names Recommended name: Protein wntless
Expression Region 36-562
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip (By similarity).
Subcellular Location Cell junction, synapse, presynaptic cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein, Endosome membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein
Protein Families Wntless family
Database Links

KEGG: dgr:Dgri_GH16661

STRING: 7222.FBpp0150567

Related Products

wls Proteins

wls Proteins for Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.