Recombinant Drosophila melanogaster Atlastin (atl)

Code CSB-CF892707DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
atl
Uniprot No.
Alternative Names
atl; CG6668; Atlastin
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-541
Target Protein Sequence
MGGSAVQVINASEEHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLR YMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILL DTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTG KKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHISSCFTEVA CFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDL IQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTA HLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKNIFKAA RTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALWAYIRYSGELSDFGG KLDDFATLLWEKFMRPIYHGCMEKGIHHVATHATEMAVGGGAASYRSQTSVNASNGKVKR S
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
GTPase tethering membranes through formation of trans-homooligomers and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis. May also regulate microtubule polymerization and Golgi biogenesis. Required for dopaminergic neurons survival and the growth of muscles and synapses at neuromuscular junctions.
Gene References into Functions
  1. Trafficking defects produced by Atlastin dysfunction in motor neurons result in redistribution of presynaptic components and aberrant mobilization of synaptic vesicles. PMID: 28860117
  2. this paper shows that atl is required in motor neurons to affect transmitter release PMID: 26906425
  3. purified and reconstituted human ATL1 exhibited no in vitro fusion activity. When the cytosolic segment of human ATL1 was connected to the transmembrane (TM) region and C-terminal tail (CT) of Drosophila ATL PMID: 25407413
  4. Data indicate that expression of either the K320E or E328R atlastin GTPase (D-ATL) variant led to dominant-negative perturbations of the endoplasmic reticulum. PMID: 25253720
  5. Data indicate that GTP hydrolysis is required for atlastin (ATL)-mediated vesicle tethering. PMID: 25825753
  6. These data suggest that the C-terminal tail of Atlastin locally destabilizes bilayers to facilitate membrane fusion. PMID: 25555915
  7. The homotypic fusion of endoplasmic reticulum membranes is mediated by atlastin through lipid interaction with the C terminus and association of the transmembrane segments. PMID: 22802620
  8. increasing the distance of atlastin complex formation from the membrane inhibits fusion, suggesting that this distance is crucial for atlastin to promote fusion PMID: 21930898
  9. atlastin dimerizes in the presence of GTPgammaS but is monomeric with GDP or without nucleotide. Oligomerization requires the juxtamembrane middle domain three-helix bundle, as does efficient GTPase activity. PMID: 21690399
  10. Loss of spastic paraplegia gene atlastin induces age-dependent death of dopaminergic neurons in Drosophila PMID: 17030474
  11. results suggest that Atlastin controls synapse development and ER and Golgi morphogenesis by regulating microtubule stability PMID: 19341724
  12. results demonstrate that Atlastin mediates membrane tethering and fusion and strongly suggest that it is the GTPase activity that is required for endoplasmic reticulum homotypic fusion PMID: 19633650

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Note=Colocalizes with microtubules (PubMed:19341724).
Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Tissue Specificity
Ubiquitously expressed.
Database Links

KEGG: dme:Dmel_CG6668

STRING: 7227.FBpp0084036

UniGene: Dm.31277

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1