Recombinant Drosophila melanogaster Frizzled (fz)

Code CSB-CF325586DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
fz
Uniprot No.
Alternative Names
fz; CG17697; Frizzled; Frizzled-1; dFz1
Species
Drosophila melanogaster (Fruit fly)
Expression Region
19-581
Target Protein Sequence
YDQSPLDASPYYRSGGGLMASSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHT KQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILERPIPPCRSLCESARVCEKLM KTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPH RNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHAMFFPERERTVLRYWVGSWAAVCV ASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSVSCREPFPPPVKL GRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENK SHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGA LFLLAGFISLFRIRTVMKTDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFD EWMIQWHRDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTM VSWRNFVERLQGKEPRTRAQAYV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Required to coordinate the cytoskeletons of epidermal cells to produce a parallel array of cuticular hairs and bristles.
Gene References into Functions
  1. The stabilizing function of Prickle on Frizzled requires Prickle activity in neighboring cells. Conversely, Prickle in the same cell has a destabilizing effect on Frizzled. PMID: 28918952
  2. instructive input of Frizzled-Planar cell polarity (Fz/PCP) signalling into polarized centriole positioning in Drosophila wings, is reported. PMID: 27021213
  3. Studies indicate that Frizzled (Fz) is constitutively ubiquitinated and internalized to the early endosome. PMID: 22825661
  4. We found no evidence for an essential requirement of the Fz C-terminal tail downstream of the KTxxxW motif in planar polarity and canonical Wnt signaling. PMID: 23023003
  5. Dissecting the molecular bridges that mediate the function of Frizzled in planar cell polarity. PMID: 22949620
  6. Frazzled is expressed and cell autonomously required in R8 photoreceptors for directing their axons to the medulla-neuropil layer M3. PMID: 22794263
  7. Frizzled and Dishevelled are enriched at distal sides of each cell and hence localize at the interface with ligand-expressing cells in the non-responding cells. PMID: 22736244
  8. Correct specification of a single R3 cell per ommatidium is essential for the normal interpretation of the Fz-mediated polarity signal. PMID: 9651479
  9. Frizzled is involved in positional information signaling during development in the coordinated orientation of ommatidia in the Drosophila eye. PMID: 11893338
  10. Function is dependent on inturned protein and on fuzzy protein. PMID: 11973308
  11. Pk causes fz to have an asymmetric localization in the cytoplasm of Drosophila. PMID: 12015986
  12. role of dachsous and fat acting upstream of frizzled in regulation of ommatidia orientation PMID: 12062069
  13. Genetic interactions and epistasis analysis suggest that frizzled, dishevelled,and fat act together in the long-range propagation of polarity signals in the eye and wing. PMID: 12479810
  14. Data show that Dishevelled (Dvl) binding peptides of Frizzled inhibited canonical Wnt signaling and blocked Wnt-induced secondary axis formation in a dose-dependent manner, but did not block noncanonical Wnt signaling. PMID: 14636582
  15. We propose a model whereby the dPatj/aPKC complex regulates PCP by inhibiting Fz1 in cells where it should not be active. PMID: 15907474
  16. Frizzled signalling is promoted by binding of Diego with Dishevelled. PMID: 15937478
  17. Drosophila frizzled controls planar cell polarity and Armadillo signaling by a common mechanism. PMID: 16085697
  18. Fz activates signaling in two steps: Fz uses its cysteine-rich domain to capture Wingless, and once bound Wg interacts with the membrane portion of the receptor to initiate signaling. PMID: 16163385
  19. wing cells acquire planar polarity along the proximal-distal axis, and Frizzled localizes at the distal side PMID: 16459300
  20. Drosophila planar cell polarity is under the hierarchical control of Frizzled (Fz)-a serpentine receptor (that also functions in the Wnt signaling pathway) [review] PMID: 17102631
  21. examined the role of a Dsh-binding PCP molecule, Diego (Dgo), in both Wnt-Fz/beta-catenin and Fz/PCP signaling PMID: 18065209

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor Fz/Smo family
Database Links

KEGG: dme:Dmel_CG17697

STRING: 7227.FBpp0303135

UniGene: Dm.1456

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1