Recombinant Drosophila melanogaster Gustatory receptor 68a(Gr68a)

Code CSB-CF893802DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9VTN0
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGLGRWYGRLVALIILIGSLTLGEDVL FASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYL LANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTL LALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCV AGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVIC SACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFK IFSAVTTYLVILIQFKQLEDSKVEDISQA
Source in vitro E.coli expression system
Gene Names Gr68a
Protein Names Recommended name: Gustatory receptor 68a
Expression Region 1-389
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Dsx-dependent essential component of pheromone-driven courtship behavior
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Tissue Specificity Expressed in chemosensory neurons of about 20 male-specific gustatory bristles in the forelegs (PubMed:12971900). No expression is seen in the mechanosensory neurons (PubMed:12971900). In larvae, expressed in the ventral pharyngeal sense organ (PubMed:220
Database Links

KEGG: dme:Dmel_CG7303

STRING: 7227.FBpp0075849

UniGene: Dm.27850

Related Products

Gr68a Antibodies

Gr68a Antibodies for Drosophila melanogaster (Fruit fly)

Gr68a Proteins

Gr68a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.