Recombinant Drosophila melanogaster Innexin inx2 (inx2)

Code CSB-CF895095DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Inx2
Uniprot No.
Alternative Names
Inx2; prp33; CG4590; Innexin inx2; Innexin-2; Gap junction protein prp33; Pas-related protein 33
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-367
Target Protein Sequence
MFDVFGSVKGLLKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIP LGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQA ILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNFYAFRF FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRH LLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSA HKRPFDA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural components of the gap junctions. Involved in gap junctional communication between germline and somatic cells which is essential for normal oogenesis. In embryonic epidermis, required for epithelial morphogenesis. Required for keyhole formation during early stages of proventriculus development in response to wg signaling. In follicle cells, promotes the formation of egg chambers in part through regulation of shg and baz at the boundary between germ cells and follicle cells. In inner germarial sheath cells, required for survival of early germ cells and for cyst formation.
Gene References into Functions
  1. Inx2 mediated calcium flux in the follicle cells stimulates endocytosis by altering Dynamin (Shibire) distribution which is critical for careful calibration of STAT activation and, thus for border cell specification. PMID: 28114410
  2. inx2 is required for the transcriptional activation of dpp and punt in the eye disc. PMID: 26455410
  3. Downregulation of either ogre or inx2 selectively in glia, by targeted expression of RNA interference transgenes, leads to a significant reduction in the size of the larval nervous system and behavioural defects in surviving adults. PMID: 23813964
  4. Data propose that Inx3 is a critical factor for dorsal closure and that it mediates the stability of Inx1, 2 and DE-cadherin by forming a complex. PMID: 23894431
  5. Innexin2 gap junctions in somatic support cells are required for cyst formation and for egg chamber formation in Drosophila. PMID: 22001874
  6. role of the innexin 2 and ogre genes during gastrointestinal development of the fly embryo PMID: 12064608
  7. first study of cellular distribution and protein-protein interactions of an innexin gap junctional channel protein (inx2) in the developing epithelia of Drosophila PMID: 15047872
  8. innexin 2 is positioned apico-laterally as well as apically between follicle cells and germ-line cells. Innexin 2 is participating in cell-cell communication via hemichannels residing in the oolemma PMID: 19038051

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Cytoplasm. Apical cell membrane. Apicolateral cell membrane. Basolateral cell membrane. Lateral cell membrane. Note=In ovary, localizes to the apicolateral membrane between follicle cells and to the apical membrane between follicle cells and germline cells. Accumulates in the apicolateral membrane of epithelial cells in the epidermis. In salivary gland cells, accumulates in the basolateral membrane. In hindgut epithelial cells, accumulates in the lateral membrane. In nurse cells, localizes around the nuclei at oogenesis stage 10a and then, during stages 10b and 11, in cytoplasmic clouds and particles which become delivered into the oocyte during nurse cell regression.
Protein Families
Pannexin family
Tissue Specificity
In ovary, expressed in inner germarial sheath cells, prefollicular cells, follicle cells, nurse cells and oocytes. Expressed in embryonic epithelial cells. Expressed in foregut and hindgut from stage 11-17, segmentally repeated tracheal placodes at stage
Database Links

KEGG: dme:Dmel_CG4590

STRING: 7227.FBpp0070966

UniGene: Dm.3095

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1