Recombinant Drosophila melanogaster Opsin Rh1 (ninaE)

Code CSB-CF356697DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ninaE
Uniprot No.
Alternative Names
ninaE; Rh1; CG4550; Opsin Rh1; Neither inactivation nor afterpotential E protein; Outer R1-R6 photoreceptor cells opsin
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-373
Target Protein Sequence
MESFAVAAAQLGPHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMI GMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGP MMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIW CLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAA VSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGL FKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDA QSQATASEAESKA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Gene References into Functions
  1. Organisms use multiple strategies to maximize visual capabilities in different light conditions. Many invertebrates show a daily cycle of shedding the photoreceptor's rhabdomeric membranes at dawn and rebuilding these during the following night. We show here that the Aedes aegypti mosquito possesses two distinct light-driven cellular signaling processes for modulating rhodopsin content during this cycle. PMID: 27798185
  2. Data show that site-directed mutagenesis of conserved residues has only modest effects on Rhodopsin 1 absorption. PMID: 26195627
  3. Data indicate that mutations in Golgi SNARE protein gos28 lead to defective rhodopsin (Rh1) trafficking. PMID: 25261468
  4. GPI biosynthesis is essential for rhodopsin sorting at the trans-Golgi network in Drosophila photoreceptors PMID: 23250212
  5. Our results indicate that fatp promotes photoreceptor survival by regulating Rh1 abundance PMID: 22844251
  6. Dominant rhodopsin (ninaE) mutants showed progressive age-dependent and light-independent loss of the deep pseudopupil. PMID: 22194648
  7. Data propose that Rh1 function in promoting RTW morphogenesis is not only needed to sustain apical membrane delivery but is also required for proper rhabdomeric membrane endocytosis and turnover. PMID: 21486953
  8. mutation of ninaE encoding Drosophila rhodopsin eliminates thermotactic discrimination in the comfortable temperature range; propose that rhodopsins represent a class of evolutionarily conserved GPCRs required for initiating thermosensory signaling PMID: 21393546
  9. Data show tat mutant flies bearing certain ninaE alleles have dramatically reduced rhodopsin-1 protein levels. PMID: 19805114
  10. expression of ceramidase facilitates the dissolution of incompletely formed and inappropriately located elements of rhabdomeric membranes in ninaE(I17) mutants lacking the G protein receptor Rh1 in R1-R6 photoreceptor cells PMID: 14769922
  11. NinaE(pp100) represented the first rhodopsin mutation that stabilized rhodopsin-arrestin complex and led to elevated levels of G(q)alpha in the cytosol, which mediated a novel retinal degeneration pathway PMID: 15014127
  12. We present evidence that the Drosophila GBS regulatory element (Glass-binding site), derived from the Rh1 rhodopsin gene, is able to drive in vivo eye-specific expression of a Ccwhite+ transgene in the Mediterranean fruitfly Ceratitis capitata. PMID: 16756553
  13. Data show that the double Rhodopsin 1 (ninaE) and Rhodopsin mutant was not entrained to red light. PMID: 18766027

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Database Links

KEGG: dme:Dmel_CG4550

STRING: 7227.FBpp0083266

UniGene: Dm.6744

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×