Recombinant Drosophila melanogaster PDF receptor (Pdfr)

Code CSB-CF894778DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Pdfr
Uniprot No.
Alternative Names
Pdfr; gop; Han; CG13758; PDF receptor; Pigment-dispersing factor receptor; Protein groom-of-PDF
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-669
Target Protein Sequence
MTLLSNILDCGGCISAQRFTRLLRQSGSSGPSPSAPTAGTFESKSMLEPTSSHSLATGRV PLLHDFDASTTESPGTYVLDGVARVAQLALEPTVMDALPDSDTEQVLGNLNSSAPWNLTL ASAAATNFENCSALFVNYTLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTR KFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRT RTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRR GNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFP LKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFC FLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWS YGTHFLTSFQGFFIALIYCFLNGEVRAVLLKSLATQLSVRGHPEWAPKRASMYSGAYNTA PDTDAVQPAGDPSATGKRISPPNKRLNGRKPSSASIVMIHEPQQRQRLMPRLQNKAREKG KDRVEKTDAEAEPDPTISHIHSKEAGSARSRTRGSKWIMGICFRGQKVLRVPSASSVPPE SVVFELSEQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for PDF, a neuropeptide controlling circadian behavioral rhythms. Probably regulates circadian behavioral rhythms through coordination of activities of clock neurons. PDF-binding results in the elevation of cAMP synthesis. Plays a role in sleep regulation and regulates the state transition from sleep to wake.
Gene References into Functions
  1. Body temperature rhythm (BTR) is fundamental for the maintenance of functions essential for homeostasis, such as generating metabolic energy and sleep. One major unsolved question is how body temperature decreases dramatically during the night. Previously, we demonstrated that a BTR-like mechanism, referred to as temperature preference rhythm (TPR), exists in Drosophila Here, we demonstrate that the diuretic hormone 31 (D PMID: 27852781
  2. Drosophila master pacemaker neurons perceive both PDF and glutamate via PDFR and mGluRA G-protein coupled receptors that increase or decrease intracellular cAMP, respectively in response to light stimulus. PMID: 25268747
  3. our study identified the Pigment Dispersing Factor Receptor (PdfR) as a regulator of flight circuit development and as a modulator of acute flight PMID: 24098151
  4. we show that PDF-R in pacemakers activates a different adenylate cyclase isoform PMID: 23929551
  5. PDFR activation in LN(v)s shifts the balance of circadian activity from evening to morning, similar to behavioral responses to summer-like environmental conditions PMID: 22938867
  6. PdfR is expressed by the muscles of the excretory system, and induces cAMP increases that underlie the myotropic effects of PDF. PMID: 22778427
  7. PDFR and CRY signaling converge in a subset of clock neurons to modulate the amplitude and phase of circadian behavior in Drosophila PMID: 21559487
  8. Data suggest that small lateral PDF receptor-containing neurons directly target a subset of crucial pacemaker neurons, and that there is autocrine feedback signaling by PDF back to PDF-expressing cells. PMID: 20394051
  9. The data of this study establish the first synapse within the Drosophila circadian neural circuit and underscore the importance of Class II peptide GPCR signaling in circadian neural systems. PMID: 16242402
  10. groom-of-PDF is a G protein-coupled receptor required for neuropeptide Pigment-Dispersing Factor neuron action in circadian behavior. PMID: 16242403
  11. Han is a PDF receptor regulating circadian behavioral rhythm through coordination of activities of clock neurons. PMID: 16242407
  12. Using circuit-directed rescue of PDF receptor mutants, data show that PDF targeting of just approximately 30 non-PDF evening circadian neurons is sufficient to drive morning behavior. PMID: 19621061

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Mainly present in clock neurons of the brain. Localizes in all 4 s-LNv neurons, 1 LNd neuron, 7 DN1 neurons, and 1 DN3 neuron. In addition to the clock neurons, it is also present in approximately 13 pairs of neurons along the ventral nerve cord in third
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×