Product Details

Target Names

Pdfr

Uniprot No.

Q9W4Y2

Alternative Names

Pdfr; gop; Han; CG13758; PDF receptor; Pigment-dispersing factor receptor; Protein groom-of-PDF

Species

Drosophila melanogaster (Fruit fly)

Expression Region

1-669

Target Protein Sequence

MTLLSNILDCGGCISAQRFTRLLRQSGSSGPSPSAPTAGTFESKSMLEPTSSHSLATGRV PLLHDFDASTTESPGTYVLDGVARVAQLALEPTVMDALPDSDTEQVLGNLNSSAPWNLTL ASAAATNFENCSALFVNYTLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTR KFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRT RTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRR GNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFP LKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFC FLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWS YGTHFLTSFQGFFIALIYCFLNGEVRAVLLKSLATQLSVRGHPEWAPKRASMYSGAYNTA PDTDAVQPAGDPSATGKRISPPNKRLNGRKPSSASIVMIHEPQQRQRLMPRLQNKAREKG KDRVEKTDAEAEPDPTISHIHSKEAGSARSRTRGSKWIMGICFRGQKVLRVPSASSVPPE SVVFELSEQ

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Receptor for PDF, a neuropeptide controlling circadian behavioral rhythms. Probably regulates circadian behavioral rhythms through coordination of activities of clock neurons. PDF-binding results in the elevation of cAMP synthesis. Plays a role in sleep regulation and regulates the state transition from sleep to wake.

Gene References into Functions

Body temperature rhythm (BTR) is fundamental for the maintenance of functions essential for homeostasis, such as generating metabolic energy and sleep. One major unsolved question is how body temperature decreases dramatically during the night. Previously, we demonstrated that a BTR-like mechanism, referred to as temperature preference rhythm (TPR), exists in Drosophila Here, we demonstrate that the diuretic hormone 31 (D PMID: 27852781
Drosophila master pacemaker neurons perceive both PDF and glutamate via PDFR and mGluRA G-protein coupled receptors that increase or decrease intracellular cAMP, respectively in response to light stimulus. PMID: 25268747
our study identified the Pigment Dispersing Factor Receptor (PdfR) as a regulator of flight circuit development and as a modulator of acute flight PMID: 24098151
we show that PDF-R in pacemakers activates a different adenylate cyclase isoform PMID: 23929551
PDFR activation in LN(v)s shifts the balance of circadian activity from evening to morning, similar to behavioral responses to summer-like environmental conditions PMID: 22938867
PdfR is expressed by the muscles of the excretory system, and induces cAMP increases that underlie the myotropic effects of PDF. PMID: 22778427
PDFR and CRY signaling converge in a subset of clock neurons to modulate the amplitude and phase of circadian behavior in Drosophila PMID: 21559487
Data suggest that small lateral PDF receptor-containing neurons directly target a subset of crucial pacemaker neurons, and that there is autocrine feedback signaling by PDF back to PDF-expressing cells. PMID: 20394051
The data of this study establish the first synapse within the Drosophila circadian neural circuit and underscore the importance of Class II peptide GPCR signaling in circadian neural systems. PMID: 16242402
groom-of-PDF is a G protein-coupled receptor required for neuropeptide Pigment-Dispersing Factor neuron action in circadian behavior. PMID: 16242403
Han is a PDF receptor regulating circadian behavioral rhythm through coordination of activities of clock neurons. PMID: 16242407
Using circuit-directed rescue of PDF receptor mutants, data show that PDF targeting of just approximately 30 non-PDF evening circadian neurons is sufficient to drive morning behavior. PMID: 19621061

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Tissue Specificity

Mainly present in clock neurons of the brain. Localizes in all 4 s-LNv neurons, 1 LNd neuron, 7 DN1 neurons, and 1 DN3 neuron. In addition to the clock neurons, it is also present in approximately 13 pairs of neurons along the ventral nerve cord in third

Database Links

KEGG: dme:Dmel_CG13758

STRING: 7227.FBpp0300789

UniGene: Dm.17751

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF894778DLU
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Drosophila melanogaster PDF receptor (Pdfr)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage