Recombinant Drosophila melanogaster Protein trapped in endoderm-1 (Tre1)

Code CSB-CF868252DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Tre1
Uniprot No.
Alternative Names
Tre1; CG3171; Protein trapped in endoderm-1
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-392
Target Protein Sequence
MDQDMGMATGYFQDADMQMDEPAAATQSIYPHSATLFAAISACVFVTIGVLGNLITLLAL LKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNV AVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLFVWAVSFLLLLPPILGIWGEMG LDEATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQI AAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLPLMLANVVDDERNTS YPWLHIIASVMAWASSVINPIIYAASNRNYRVAYYKIFALLKFWGEPLSPMPSRNYHQSK NSKELSGVIRSTPLFHAVQKNSINQMCQTYSV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for the first active step of germ cell migration: transepithelial migration of germ cells through the posterior midgut (PMG) epithelium.
Gene References into Functions
  1. Bifurcation of the Tre1 G protein-coupled receptor signaling response via G protein-dependent and independent branches enables distinct spatiotemporal regulation of germ cell migration. PMID: 28687666
  2. feminizing the Tre1-expressing neurons in male flies leads to rapid courtship initiation, a phenotype that leads to increased reproductive success; Tre1 is expressed in a sexually dimorphic pattern in olfactory sensory neurons and the central nervous system PMID: 26721856
  3. role of the arginine of the NRY motif in Tre1 was investigated; results suggest that a salt bridge may form between this critical arginine and an aspartic acid in transmembrane alpha-helix (TM6)in Tre1 PMID: 24044607
  4. The scattershot allele results in an in-frame deletion of 8 amino acids at the junction of the third transmembrane domain and the second intracellular loop of Tre1 that dramatically impairs the function of this GPCR in germ cell migration. PMID: 20676220
  5. plays an important role in regulation of germ cell migration, polarity , cell adhesion, and cadherin binding. (review) PMID: 20058705
  6. Tre1 is a G protein-coupled receptor that directs transepithelial migration of Drosophila germ cells PMID: 14691551
  7. Down-regulation of E-cadherin causes germ cell dispersal but is not sufficient for transepithelial migration in the absence of Tre1, suggesting a new mechanism for Tre1 GPCR function that links cell polarity, modulation of cell adhesion, and invasion. PMID: 18824569

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
In embryos, expression is seen at highest levels in the cuprophilic cells and at lower levels in the amnioserosa, developing CNS, cardiac mesoderm primordium and midline glia.
Database Links

KEGG: dme:Dmel_CG3171

STRING: 7227.FBpp0070813

UniGene: Dm.18422

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1