Recombinant Drosophila melanogaster Protein white (w)

Code CSB-CF320613DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
w
Uniprot No.
Alternative Names
w; CG2759; Protein white
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-687
Target Protein Sequence
MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNYGTLLPPSPPEDSGSG SGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERHIPAPRKHLLKNVCGVA YPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPVDAKEMQARCAYVQQ DDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQELSLSKCQHTIIGVPGRVKG LSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGKTVILTIHQP SSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCPTNYNPADFYVQVLAVVPGRE IESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQPENGYTYKATWFMQFRAVLWRS WLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVGVMNINGAIFLFLTNMTFQNVFA TINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPLFLTVPLVFTAIAYPMIGLRAGVL HFFNCLALVTLVANVSTSFGYLISCASSSTSMALSVGPPVIIPFLLFGGFFLNSGSVPVY LKWLSYLSWFRYANEGLLINQWADVEPGEISCTSSNTTCPSSGKVILETLNFSAADLPLD YVGLAILIVSFRVLAYLALRLRARRKE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Part of a membrane-spanning permease system necessary for the transport of pigment precursors into pigment cells responsible for eye color. White dimerize with brown for the transport of guanine. Scarlet and white complex transports a metabolic intermediate (such as 3-hydroxy kynurenine) from the cytoplasm into the pigment granules.
Gene References into Functions
  1. Using a transgenic lines, we show that the Fab-7 insulator of the bithorax complex and the MDG4 (gypsy) insulator are able to disrupt weak transcription derived from the enhancer regulating the white gene expression in the eyes. PMID: 29372797
  2. data suggest that a White-cGMP interaction modulates the timing of locomotor recovery from anoxia PMID: 28060942
  3. Data suggest that age-dependent behavioral/physiological changes differ between wide-type flies (Canton-S flies) and genetically engineered flies null mutation of white gene (w1118 flies); old w1118 flies exhibit decreased path length per minute and reduced 0.2 s path increment compared with young flies, whereas old Canton-S flies exhibit same path length per minute and same 0.2 s path increment compared with young flies. PMID: 28087331
  4. White modulates the timing of locomotor recovery from anoxia. PMID: 27029736
  5. this study we have used the CRISPR/Cas9 system to introduce site-specific mutations in the D. suzukii white (w) and Sex lethal (Sxl) genes. PMID: 26721433
  6. Genetic analysis with a series of crosses revealed that the White gene was not associated with the phenotype of boundary preference in wildtype flies. PMID: 26351842
  7. it was observed that Mod(mdg4)-67.2, a component of the gypsy insulator, interacted with the Zeste protein, which is critical for the eye enhancer-white promoter communication. PMID: 23861668
  8. Using genetics and pharmacology, we identified the metabolite transporter White and white-dependent serotonin as suppressors of phototactic personality PMID: 23150588
  9. H3K9me2 levels at the white gene directly correlate with its level of expression. PMID: 22634714
  10. Data show that maize B1 transgenic lines exhibit cis-silencing of white gene but epigenetic activation of white gene expression in trans. PMID: 22729404
  11. This allele enhances mutations in the subset of other eye-color genes with phenotypes similar to garnet. PMID: 11962627
  12. The promoter and enhancer region of white gene was studied. PMID: 16480133
  13. An insulator element is almost contiguous to the white 3'UTR. PMID: 18086699
  14. Assay of cGMP transport in w(-) (mutant) tubules shows that w is required for cGMP transport but not cAMP transport. Targeted over-expression of w in w(-) tubule principal cells significantly increases cGMP transport compared with that in w(-) controls. PMID: 18310115

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasmic granule membrane; Multi-pass membrane protein. Note=Pigment granules within pigment cells and retinula cells of the compound eye (when complexed with st).
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Database Links

KEGG: dme:Dmel_CG2759

STRING: 7227.FBpp0070468

UniGene: Dm.19661

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1