Recombinant Drosophila melanogaster Putative gustatory receptor 43a (Gr43a)

Code CSB-CF895567DLU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Gr43a
Uniprot No.
Alternative Names
Gr43a; GR43.1; CG1712; Gustatory receptor for sugar taste 43a
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-427
Target Protein Sequence
MEISQPSIGIFYISKVLALAPYATVRNSKGRVEIGRSWLFTVYSATLTVVMVFLTYRGLL FDANSEIPVRMKSATSKVVTALDVSVVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLN AYNNFRRDRWRALGMAAVSLLAISILVGLDVGTWMRIAQDMNIAQSDTELNVHWYIPFYS LYFILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRP AMPSALHASLTKLNGETLPSEAAAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFIL VSCLLHLVATAYFLFLELLSKRDNGYLWVQMLWICFHFLRLLMVVEPCHLAARESRKTIQ IVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILI QFQRTNG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates. Gr43a is the main sugar receptor in larvae. Functions as a narrowly tuned fructose receptor in taste neurons but also as a fructose receptor in the brain. Necessary and sufficient to sense hemolymph fructose and promote feeding in hungry flies but suppress feeding in satiated flies.
Gene References into Functions
  1. Here we sought to decipher the genes required for fructose response among Gr64a-Gr64f genes. Unexpectedly, the qPCR analyses for these genes show that labellar expression levels of Gr64d and Gr64e are higher in fructose low-sensitivity flies than in high-sensitivity flies PMID: 29047261
  2. Gr43a is the main receptor for larval sugar preference.Late sugars preference is mediated by Gr43a-expressing brain neurons. PMID: 23850280
  3. Studies indicate that the Gr43a-expressing brain neurons function as a nutrient sensor for hemolymph fructose and assign opposing valence to feeding experiences in a satiation-dependent manner. PMID: 23178127
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Tissue Specificity
Expressed in the adult labellar chemosensory neurons and in the adult head, abdomen, leg and wing. In larvae, is expressed in taste organs, as well as the brain and the gastrointestinal system.
Database Links

KEGG: dme:Dmel_CG1712

STRING: 7227.FBpp0110117

UniGene: Dm.26868

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X