Recombinant Drosophila melanogaster Putative phosphatidate phosphatase(wun)

Code CSB-CF893233DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9V576
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Drosophila melanogaster (Fruit fly)
Sequence MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNNNYSNSVQVRL QEQDRDSDSEQQQHTATITMDTNKRILCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFC DDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNY ELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAIN AGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRH LLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDLFQKPNTKPYLA RTVQDMNASPAQAITITTN
Source in vitro E.coli expression system
Gene Names wun
Protein Names Recommended name: Putative phosphatidate phosphatase EC= 3.1.3.4 Alternative name(s): Germ cell guidance factor Phosphatidic acid phosphatase type 2 Protein wunen
Expression Region 1-379
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for guiding the germ cells early in the process of migration from the lumen of the developing gut towards the overlying mesoderm, where the germ cells enter the gonads. May be involved in lipid metabolism.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PA-phosphatase related phosphoesterase family
Tissue Specificity Expressed in embryonic gut in a pattern that guides germ cells towards mesoderm (initially in hindgut and then on lower side of gut). During extended germ band stage, expressed in ectoderm as a medial band throughout the trunk.
Database Links

KEGG: dme:Dmel_CG8804

STRING: 7227.FBpp0087635

UniGene: Dm.3348

Related Products

wun Antibodies

wun Antibodies for Drosophila melanogaster (Fruit fly)

wun Proteins

wun Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.