Recombinant Emerin homolog 1(emr-1)

Code CSB-CF519041CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O01971
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MDVSQLTDAELRDSLKSHGVSVGPIVATTRKLYEKKLIKLSDGSINNQSNLNDSQFNEDS LIISSSPKKSPPQRVFQNVSAATAAATTSPESDSDDCEESMRYLTEEEMAADRASARQAQ SNKGGFLGSTITFTILFVFIAVFAYFLIENAEQLKLVAETNPEDTI
Source in vitro E.coli expression system
Gene Names emr-1
Protein Names Recommended name: Emerin homolog 1 Alternative name(s): Ce-emerin
Expression Region 1-166
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in chromosome segregation and cell division, probably via its interaction with lmn-1, the main component of nuclear lamina
Subcellular Location Nucleus envelope, Nucleus inner membrane, Single-pass membrane protein, Nucleoplasmic side
Tissue Specificity Ubiquitous. Expressed in all cells, except in cells undergoing spermatogenesis.
Database Links

KEGG: cel:CELE_M01D7.6

STRING: 6239.M01D7.6.1

UniGene: Cel.18441

Related Products

emr-1 Antibodies

emr-1 Antibodies for Caenorhabditis elegans

emr-1 Proteins

emr-1 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.