Recombinant Escherichia coli Osmolarity sensor protein EnvZ (envZ)

Code CSB-CF365158ENV
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
envZ
Uniprot No.
Alternative Names
envZ; ompB; perA; tpo; b3404; JW3367; Sensor histidine kinase EnvZ; Osmolarity sensor protein EnvZ
Species
Escherichia coli (strain K12)
Expression Region
1-450
Target Protein Sequence
MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Member of the two-component regulatory system EnvZ/OmpR involved in osmoregulation (particularly of genes ompF and ompC) as well as other genes. EnvZ functions as a membrane-associated protein kinase that phosphorylates OmpR in response to environmental signals; at low osmolarity OmpR activates ompF transcription, while at high osmolarity it represses ompF and activates ompC transcription. Also dephosphorylates OmpR in the presence of ATP. The cytoplasmic dimerization domain (CDD) forms an osmosensitive core; increasing osmolarity stabilizes this segment (possibly by its contraction), enhancing the autophosphorylation rate and consequently, downstream phosphotransfer to OmpR and signaling. Autophosphorylation is greater when full-length EnvZ is reconstituted in a lipid environment, lipid-mediated allostery impacts the kinase function of EnvZ. Involved in acid stress response; this requires EnvZ but not OmpR phosphorylation, and suggests that EnvZ senses cytoplasmic acidic pH.
Gene References into Functions
  1. study also reveals that polyP-dependent stalling has little effect on EnvZ levels. Hence, both polyP motifs in EnvZ are primarily involved in protein-protein interaction. PMID: 29953503
  2. A library of single-Cys-containing EnvZ proteins was used to show that the major TM1-TM1' interface falls along a single surface consisting of residue positions 19, 23, 26, 30 and 34. Cys substitutions in the N- and C-terminal regions of TM1 change EnvZ signal output. Core residues in TM1 cause TM1 dimerisation and maintenance of steady-state signal output. Extracellular osmolarity does not rearrange TM1-TM1' interfaces. PMID: 27155567
  3. Cytoplasmic sensing by the inner membrane histidine kinase EnvZ PMID: 25937465
  4. structure shows an asymmetric histidine kinase dimer where one subunit is caught performing the autophosphorylation reaction PMID: 24500224
  5. Both the E. coli MG1655 and E. coli Nissle 1917 strains containing envZP41L produced more phosphorylated OmpR than their parents. PMID: 24478082
  6. HDXMS data showed that the cytoplasmic domain of EnvZ exists as an ensemble of multiple conformations and osmolytes favoured increased helicity. High osmolality increased the autophosphorylation of His243. PMID: 22543870
  7. This study report that 10 to 20% of motile E. coli MG1655 are envZ missense mutants that are better colonizers of the mouse intestine than E. coli MG1655. PMID: 22392928
  8. Direct binding studies showed that the cytoplasmic domains of these proteins each form specific homodimers in vitro. PMID: 21854787
  9. Together, the data suggest that the binding of MzrA to EnvZ influences the ability of EnvZ to receive and/or respond to environmental signals in the periplasm and modulate its biochemical output to OmpR. PMID: 20889743
  10. Data show that PerA is required for activation of the operon LEE1, but that this activation is via autoactivation of the per promoter which ensures sufficient production of the PerC protein to activate LEE1. PMID: 15522091

Show More

Hide All

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1