Recombinant Escherichia coli Small-conductance mechanosensitive channel (mscS)

Code CSB-CF314762ENV
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
mscS
Uniprot No.
Alternative Names
mscS; yggB; b2924; JW2891; Small-conductance mechanosensitive channel
Species
Escherichia coli (strain K12)
Expression Region
1-286
Target Protein Sequence
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mechanosensitive channel that participates in the regulation of osmotic pressure changes within the cell, opening in response to stretch forces in the membrane lipid bilayer, without the need for other proteins. Contributes to normal resistance to hypoosmotic shock. Forms an ion channel of 1.0 nanosiemens conductance with a slight preference for anions. The channel is sensitive to voltage; as the membrane is depolarized, less tension is required to open the channel and vice versa. The channel is characterized by short bursts of activity that last for a few seconds.
Gene References into Functions
  1. inactivation process of wild-type MscS was strongly affected by voltage. The wild-type MscS inactivated at +60 to +80 mV but not at -60 to +40 mV. PMID: 28101504
  2. Mutations in a conserved domain of E. coli MscS to the most conserved superfamily residue leads to kinetic changes. PMID: 26340270
  3. Molecular dynamics and biophysical analyses show that the volume of the pockets and thus the number of lipid acyl chains within them decreases upon channel opening. PMID: 26551077
  4. Data show that trifluoroethanol (TFE) affects mechanosensitive channel of small conductance (MscS) channel gating kinetics in spheroplasts and liposomes. PMID: 26116700
  5. Data indicate that mechanosensitive channel of small conductance (MscS) protein opens in response to a relief of intrinsic lipid bilayer pressure. PMID: 25450806
  6. We report here crystal structures of MscS from E. coli and Helicobacter pylori solubilized in the detergent beta-dodecylmaltoside at resolutions of 4.4 and 4.2 A, respectively. PMID: 23339071
  7. Article reviews the science that led to the isolation and identification of MscS. structure-function relationship of the channel, in particular the structural and biochemical approaches to understanding channel gating. [Review] PMID: 22404681
  8. Data show that the MscL/MscS threshold ratio dramatically decreased in thinner compared with thicker bilayers. PMID: 22586095
  9. Tension dependencies of both inactivation and recovery rates suggest the spatial scale of the inactivating transition, which guides the modeling of the inactivated state of MscS. PMID: 21670207
  10. Both F68S and L111S in MscS substitutions produced severe loss-of-function phenotypes in vivo by increasing the inactivation rate and promoting unusual 'silent' inactivation from the resting state PMID: 20208543
  11. the crystal structure of MscS does not represent an open state; MscS gate involves a vapor-lock mechanism where limited changes of geometry or surface polarity can locally switch the regime between water-filled (conducting)& empty (nonconducting) states PMID: 15111405
  12. The crystal structure of MscS reveals a homoheptamer with three transmembrane segments and a large cytoplasmic domain PMID: 17500538
  13. Analysis of the fluorescence properties of purified mutant MscS proteins containing single Trp residues revealed that W16 and W251 are relatively inaccessible, whereas W240 is accessible to quenching agents. PMID: 17718516
  14. Transition to this unique mechanosensitive channel state is discussed in terms of existing data. PMID: 18065458
  15. study presents a 3.45 angstrom-resolution structure for the MscS channel in an open conformation; structure suggests a molecular mechanism that underlies MscS gating and its decay of conductivity during prolonged activation PMID: 18755969
  16. determination of structural rearrangements associated with MscS activation in membranes; transition from closed to open state is accompanied by downward tilting of the transmembrane TM1-TM2 hairpin & by expansion, tilt & rotation of the TM3 helices PMID: 18755978
  17. MscL and MscS are tangible models for studying conformational transitions in membrane proteins driven directly by membrane tension. PMID: 19383606

Show More

Hide All

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Protein Families
MscS (TC 1.A.23) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1