Recombinant Human ADP/ATP translocase 1 (SLC25A4)

Code CSB-CF021510HU
Abbreviation Recombinant Human SLC25A4 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
ADP,ATP carrier protein 1;ADP,ATP carrier protein, heart/skeletal muscle isoform T1;Adenine nucleotide translocator 1;Solute carrier family 25 member 4
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
2-298aa
Target Protein Sequence
GDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.4
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane. In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis. Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A4/ANT1 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity). Proton transporter activity requires free fatty acids as cofactor, but does not transport it. Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death. It is however unclear if SLC25A4/ANT1 constitutes a pore-forming component of mPTP or regulates it. Acts as a regulator of mitophagy independently of ADP:ATP antiporter activity: promotes mitophagy via interaction with TIMM44, leading to inhibit the presequence translocase TIMM23, thereby promoting stabilization of PINK1.
Gene References into Functions
  1. Patients with SLC25A4 (ANT1) gene mutations present a common phenotype with exercise intolerance, hyperlactatemia, and hypertrophic cardiomyopathy. PMID: 28823815
  2. NF-kappaB signalling may repress ANT1 gene transcription and impair mitochondrial functions. PMID: 28317877
  3. Data indicate that by inhibiting adenine nucleotide translocase 1 (ANT1) and mitochondrial dysfunction, tyrosine phosphatase SHP2 orchestrates an intrinsic regulatory loop to limit excessive NLR family, pyrin domain-containing 3 protein (NLRP3) inflammasome activation. PMID: 29255148
  4. ANT1 confers sensitivity of the mitochondrial permeability transition pore to the electrochemical gradient. PMID: 27221760
  5. These findings suggest that DRAK1 translocates in response to stimuli and induces apoptosis through its interaction with specific binding partners, p53 and/or ANT2. PMID: 29397938
  6. Yeast aac2 R96H and aac2 R252G mutations are equivalent to R80H and R235G human ANT1 pathological mutations. mtDNA instability induced by aac2R96H and aac2R252G is rescued by N-acetylcysteine. PMID: 28947214
  7. identification by whole-exome sequencing of seven probands harboring dominant, de novo SLC25A4 mutations; all affected individuals presented at birth, were ventilator dependent and, where tested, revealed severe combined mitochondrial respiratory chain deficiencies associated with a marked loss of mitochondrial DNA copy number in skeletal muscle PMID: 27693233
  8. A directed proteomic approach discovered the novel interaction of BKCa with Tom22, a component of the mitochondrion outer membrane import system, and the adenine nucleotide translocator (ANT). PMID: 27592226
  9. Identification of ZNF555 as a putative transcriptional factor that impacts ANT1 promoter activity in facioscapulohumeral dystrophy myoblasts. PMID: 26184877
  10. elevated ANT1 expression supports EV infection and is associated with EV persistence, a condition with adverse prognosis. PMID: 24485628
  11. Mitochondrial DNA (mtDNA) content plays an important role in energy production and sustaining normal physiological function. PMID: 24524965
  12. Data suggest acetylation of ANT1 at lysines 10/23/92 has dramatic physiological effects on ADP-ATP exchange; extent of acetylation of lysine 23 decreases following physical activity; this change is highly dependent on insulin sensitivity/resistance. PMID: 24884163
  13. Expression of ANT1 were lower in inclusion body myositis samples versus both polymyositis and controls PMID: 22350218
  14. Compares and contrasts all the known human SLC25A* genes and includes functional information. PMID: 23266187
  15. A 13-generation Mennonite pedigree with autosomal recessive myopathy and cardiomyopathy due to an SLC25A4 frameshift null mutation (c.523delC, p.Q175RfsX38), which codes for the heart-muscle isoform of the adenine nucleotide translocator-1, was studied. PMID: 23401503
  16. This report expands the clinical spectrum of ANT1-related human diseases, and emphasises the crucial role of the mitochondrial ADP/ATP carriers in muscle function and pathophysiology of human myopathies. PMID: 22187496
  17. mutant human ANT1 causes dominant mitochondrial defects characterized by decreased ADP-ATP exchange function and abnormal translocator reversal potential PMID: 21586654
  18. There was no significant difference in slc25a4 mRNA expression between the AML patients with complete remission and those without remission. PMID: 19840444
  19. The respiratory-dependent assembly of ANT1 differentially regulates Bax and Ca2+ mediated cytochrome c release. PMID: 21196320
  20. Data show that MeCP2 cooperates with YY1 in repressing the ANT1 gene encoding a mitochondrial adenine nucleotide translocase. PMID: 20504995
  21. The reduction of ANT1 density below a physiological baseline impairs fundamental functions of this protein in ADF cells, leading them to undertake a cell death process. PMID: 20528917
  22. The heterologous expression of ANT1 on endothelial cell membrane enhances the tissue-type plasminogen activator binding ability of endothelial cells and enhances their fibrinolytic properties. PMID: 20160640
  23. Tyrosine phosphorylation by Src within the cavity of the adenine nucleotide translocase 1 regulates ADP/ATP exchange in mitochondria. PMID: 20007455
  24. PGC-1alpha regulates reactive oxygen species generation and apoptosis in endothelial cells by increasing fatty acid oxidation and enhancing ATP/ADP translocase activity. PMID: 19965780
  25. A114P missense mutation in the human Ant1 protein was found to be associated with autosomal dominant progressive external ophthalmoplegia PMID: 12140186
  26. ANC1 is able to restore growth on a nonfermentable carbon source of a yeast mutant strain, and its N-terminal region proves important for its biogenesis and transport activity in yeast mitochondria. PMID: 12450408
  27. Autosomal dominant external ophthalmoplegia and bipolar affective disorder associated with a mutation in the ANT1 gene. PMID: 12565915
  28. Inhibition of the PT-pore (ANT-1) via up-regulation of cyclophilin D plays a role in tumorigenesis. PMID: 14729611
  29. adenine nucleotide translocase 1-induced apoptosis requires nuclear factor B recruitment into mitochondria PMID: 15231833
  30. Increased ANT1 expression and mitochondrial dysfunction may thus be initial events in facioscapulohumeral muscular dystrophy pathogenesis PMID: 15551024
  31. report a novel heterozygous C to A transversion at nucleotide 269 in the ANT1 gene in a German family with Progressive External Ophthalmoplegia , predicted to convert a highly conserved alanine at codon 90 to aspartic acid. PMID: 15792871
  32. After the training period, intracellular energetic units had a higher control of mitochondrial respiration by creatine linked to a more efficient functional coupling adenine nucleotide translocase-mitochondrial creatine kinase. PMID: 16020522
  33. The altered isoform expression in DCM hearts entails changes in the kinetic properties of total ANT protein restricting ANT function and contributing to disturbed energy metabolism in DCM. PMID: 16107323
  34. Dominant missense mutations were found in the gene encoding the heart and skeletal muscle-specific isoform of the adenine nucleotide translocator (ANT1) in families with autosomal dominant progressive external opthalmoplegia and in a sporadic patient PMID: 16155110
  35. Results revealed that ANT1 and ANT3 (adenine nucleotide translocase 1-3) over-expressing HeLa cells increased their atRA sensitivity. PMID: 16556444
  36. these data provide evidence for the involvement of ANT-1 and ANT-3 in the induction of the mitochondrial permeability transition pore and indicate the relevance of this phenomenon in ER-mitochondria Ca2+ transfer. PMID: 16887100
  37. ANT1 and PolgammaA, which cause additive, deleterious effects on mtDNA maintenance and integrity,complex encephalomyopathy. PMID: 18504126
  38. Data show that ANT1 has a role in determining familial progressive external ophthalmoplegia. PMID: 18575922
  39. differently from normal myoblasts, the 4qA/B marker interacted directly with the promoters of the FRG1 and ANT1 genes in Facio-Scapulo-Humeral Dystrophy cells PMID: 18852887
  40. the presence of the functionally inert catalytic domain alone was sufficient to cause the MT1-MMP to interact with ANT2, thus indicating that there is a non-proteolytic mode of these interactions PMID: 19232058
  41. Association of the T(-365)C POLG1, G(-25)A ANT1 and G(-605)T PEO1 gene polymorphisms with diabetic polyneuropathy in patients with type 1 diabetes mellitus PMID: 19425506

Show More

Hide All

Involvement in disease
Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal dominant, 2 (PEOA2); Mitochondrial DNA depletion syndrome 12B, cardiomyopathic type (MTDPS12B); Mitochondrial DNA depletion syndrome 12A, cardiomyopathic type (MTDPS12A)
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Expressed in erythrocytes (at protein level).
Database Links

HGNC: 10990

OMIM: 103220

KEGG: hsa:291

STRING: 9606.ENSP00000281456

UniGene: Hs.246506

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*