Recombinant Human Adiponectin receptor protein 2 (ADIPOR2)

Code CSB-CF768214HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ADIPOR2
Uniprot No.
Alternative Names
ADIPOR2; PAQR2; Adiponectin receptor protein 2; Progestin and adipoQ receptor family member 2; Progestin and adipoQ receptor family member II
Species
Homo sapiens (Human)
Expression Region
1-386
Target Protein Sequence
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF VHFHGVSNLQEFRFMIGGGCSEEDAL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.
Description

The recombinant Human ADIPOR2 protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, ADIPOR2 proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.

ADIPOR2 is primarily expressed by the liver. ADIPOR2 activates PPARα to facilitate fatty acid catabolism by upregulating genes involved in fatty acid transport, binding and activation, and peroxisomal and mitochondrial fatty acid β-oxidation. ADIPOR2 deficiency reduces PPARα activity. The adiponectin resistance and sensitivity mediated by ADIPOR2 in hepatocytes modulated steatohepatitis progression by changing PPARα activity and ROS accumulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal body fat and glucose homeostasis. ADIPOQ-binding activates a signaling cascade that leads to increased PPARA activity, and ultimately to increased fatty acid oxidation and glucose uptake. Has intermediate affinity for globular and full-length adiponectin. Required for normal revascularization after chronic ischemia caused by severing of blood vessels.
Gene References into Functions
  1. There were no significant associations involving ADIPOR2 with diabetes and hypertriglyceridemia in an admixed Latin American population. PMID: 29145541
  2. the findings of the present case-control study further exemplify the role of AdipoR2 genetic polymorphisms (rs10773989 and rs1044471) and its protein expression in colorectal carcinogenesis and advancement. PMID: 28765899
  3. Two polymorphisms, rs2241766 in ADIPOQ gene and rs10773989 in ADIPOR2 gene, especially under the recessive model of inheritance, played independent leading roles in susceptibility to myocardial infarction in Han Chinese. PMID: 29524572
  4. The results indicated that globular adiponectin inhibited the prooncogenic effects of leptin via AdipoR2-mediated suppression of UHRF1 PMID: 28285359
  5. Variants of ADIPOR2 could be a determinant for higher FFA levels, and among Chinese Han population, carriers of the CT and TT genotypes for rs2370055 even with normal glucose levels may have significantly higher insulin resistance susceptibility. PMID: 27348122
  6. We conclude that the PAQR-2 and AdipoR2 proteins share an evolutionarily conserved function that maintains membrane fluidity in the presence of exogenous saturated fatty acids. PMID: 28886012
  7. Renoprotection of adiponectin is associated with improvement of the endothelial dysfunction, reduction of oxidative stress, and upregulation of endothelial nitric oxide synthase expression through activation of adenosine 5'-monophosphate-activated protein kinase by AdipoR1 and activation of peroxisome proliferator-activated receptor (PPAR)-alpha signaling pathway by AdipoR2. [review] PMID: 28402446
  8. crystal structure of ADIPOR2 bound to a FFA molecule and show that ADIPOR2 possesses intrinsic basal ceramidase activity that is enhanced by adiponectin PMID: 28329765
  9. Adiponectin stimulates cPLA2 and COX-2 expression via AdipoR1/2-dependent activation of PKC/NADPH oxidase/mitochondria resulting in ROS accumulation, p300 phosphorylation, and histone H4 acetylation. PMID: 27288489
  10. These results indicate that miR-150 can attenuate oxidized low-density lipoprotein - induced lipid accumulation in macrophages via promotion of cholesterol efflux. The suppressive effects of miR-150 on macrophage foam cell formation are mediated through targeting of AdipoR2. PMID: 27216461
  11. Decreased expression of ADIPOR2 is associated with polycystic ovary syndrome. PMID: 27075719
  12. Strong Functional Association of adipor2 and cdh13 with adipoq PMID: 25388841
  13. PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of adiponectin system in GCs of polycystic ovary syndromepatients compared to those in controls PMID: 26631404
  14. Endometriotic stromal cell proliferation is linked to increased expression of AdipoR2 (and AdipoR1) gene receptor expression. PMID: 26459399
  15. Results identified miR-375 and its direct target, ADIPOR2 as androgen regulated molecules suggesting an important role in the mechanism of the increase in visceral fat mass and the associated insulin resistance caused by testosterone deficiency. PMID: 26219823
  16. Two ADIPOR2 SNPs (rs11061925 and rs929434) were associated with fasting plasma triglyceride concentrations in the entire sample of HIV-infected patients. PMID: 26111083
  17. In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectin PMID: 26146630
  18. Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2. PMID: 25892445
  19. Data indicate the thermal stability of purified N-terminally truncated mutants of adiponectin receptors AdipoR1 and AdipoR2. PMID: 25575462
  20. This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors. PMID: 25640382
  21. crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 A and 2.4 A resolution, respectively PMID: 25855295
  22. down-regulation of adiponectin receptors (AdipoR1, R2, and T-cadherin) in osteoarthritic chondrocytes PMID: 24888493
  23. These results strengthen the evidence for the role of AdipoR2 in prostate cancer progression. PMID: 25863129
  24. AA genotype and A allele of rs12342 in the adiponectin receptor 2 gene may increase the risk of ischemic stroke, particularly the risk of atherosclerosis cerebral infarction PMID: 25299095
  25. miR-423-3p plays a novel oncogenic role in laryngeal cancer via AdipoR2 suppression. PMID: 25337209
  26. In conclusion, all these observations suggest that adiponectin influences bone metabolism decreasing the levels of bone formation. PMID: 24673523
  27. The improvement of insulin sensitivity by physical exercise is related to adiponectin and/or AdipoR1/R2 expression changes. PMID: 25126860
  28. macrophage polarization is a key determinant regulating AdipoR expression and differential APN-mediated macrophage inflammatory responses PMID: 25392268
  29. In those with advanced stage gastric cancer, 7 of 39 had low Adipo-R1 expression (17.9%) and 16 had low Adipo-R2 expression (41%). PMID: 24969908
  30. Low ADIPOR2 expression is associated with hepatocellular carcinoma. PMID: 24619866
  31. AdipoR1 stimulates IL10 production by activating the AMPK and MAPKp38 pathways, whereas AdipoR2 modifies inflammatory processes by activating the COX-2 and PPARG pathways. PMID: 25261236
  32. adiponectin receptors(AdipoR1 and -R2 ) are located, or re-located, in the plasma membrane with distribution in the cytoplasm when mononuclear cells are committed to differentiate to osteoclasts. PMID: 23971629
  33. AdipoR2 is regulated by the LH receptor function via a cAMP dependent mechanism. PMID: 23779096
  34. SNPs of both the adiponectin gene and its receptors AdipoR1 and AdipoR2 (including their haplotypes) appear as candidate genes and involved in the development of the state of insulin resistance. PMID: 23656997
  35. Studies indicate that altered levels of adiponectin and leptin or their cognate receptors in cancers can ultimately lead to an imbalance in downstream molecular pathways. PMID: 23355630
  36. APN, AdipoR1, and AdipoR2 exist in human and mouse retinas and retinal APN and AdipoR1 protein levels are elevated in type 1 diabetes mellitus mice. PMID: 23922494
  37. Collectively these studies demonstrate that the non-conserved region of AdipoR2 restricts its cell-surface expression and raise the possibility that the majority of cell-surface AdipoR2 may be present in the form of heterodimers. PMID: 23376713
  38. Data indicate that AdipoR1 was expressed in 27 % of primary tumors and AdipoR2 in 47 %. PMID: 22907586
  39. High AdipoR2 expression is associated with gastric carcinoma. PMID: 23358721
  40. Circulating concentrations of adiponectin were not affected by type I diabetes, but expression of adiponectin receptors on blood monocytes was markedly reduced and inversely associated with insulin resistance. PMID: 23386639
  41. The pleiotropic, tissue-dependent functions of adiponectin depend on the expression levels of AdipoR1 and AdipoR2. PMID: 23255609
  42. Reduced hepatic expression of adiponectin and adipoR2 might be of pathophysiological relevance in chronic hepatitis B patients with metabolic syndrome. PMID: 22819899
  43. Increased mRNA and protein expression of adiponectin receptors is related with increased aortic stiffness, coronary and peripheral atherosclerosis in patients with coronary artery disease. PMID: 22534793
  44. Adiponectin differentially alters the expression of Adipor1/Adipor2 as well as genes related to steroidogenesis, ovulation, and apoptosis in cumulus cells versus granulosa cells. PMID: 22633650
  45. adiponectin receptor-2 795G/A polymorphisms and relation with insulin resistance PMID: 22187345
  46. In a Finnish type 2 diabetes population, four SNPs in ADIPOR2 (rs10848554, rs11061937, rs1058322, rs16928751) are associated with cardiovascular disease risk, and two remain significant. PMID: 21943112
  47. While the decrease in leptin receptor levels in chronic myeloid leukemia patients was confirmed, the increase in AdipoR1 levels and relevant decrease in AdipoR2 levels depicted their possible involvement in chronic myeloid leukemia pathogenesis. PMID: 22082804
  48. Authors evaluated 29 common single-nucleotide polymorphisms (SNP) in ADIPOQ (n = 13), ADIPOR1 (n = 5), and ADIPOR2 (n = 11) in relation to the risk of prostate cancer. PMID: 21960694
  49. Adiponectin suppression of macrophage lipid accumulation/foam cell formation is mediated through AdipoR1/AdipoR2/APPL1. AdipoR1 and AdipoR2 exhibited a differential ability to regulate inflammatory cytokines and SR-A1. PMID: 22227293
  50. In vitro and ex vivo evidence for a causal role of adiponectin in endometrial cancer. PMID: 21980131

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
ADIPOR family
Tissue Specificity
Ubiquitous. Highly expressed in skeletal muscle, liver and placenta. Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung.
Database Links

HGNC: 24041

OMIM: 607946

KEGG: hsa:79602

STRING: 9606.ENSP00000349616

UniGene: Hs.371642

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1