Recombinant Human Alpha-1B adrenergic receptor (ADRA1B)

Code CSB-CF001386HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ADRA1B; Alpha-1B adrenergic receptor; Alpha-1B adrenoreceptor; Alpha-1B adrenoceptor
Species
Homo sapiens (Human)
Expression Region
1-520
Target Protein Sequence
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes.
Gene References into Functions
  1. ADRA1B rs10070745 was significantly associated with vasoconstrictor responses. PMID: 27089938
  2. Receptor Species-dependent Desensitization Controls KCNQ1/KCNE1 K+ Channels as Downstream Effectors of Gq Protein-coupled Receptors.( PMID: 27834678
  3. protein kinase C modulates alpha1B-adrenergic receptor transfer to late endosomes and that Rab9 regulates this process and participates in G protein-mediated signaling turn-off. PMID: 28082304
  4. eIF3f/alpha adrenergic receptor interaction PMID: 26497985
  5. heteromeric receptor complexes between alpha1A-AR and CXCR4 and between alpha1B-AR and CXCR4 are constitutively expressed in rat and human vascular smooth muscle cells; the quaternary structure of the receptor complex is important for signaling and contraction PMID: 25775528
  6. alpha1B-AR signals through calcium, ERK1/2 and p38 only when located in the membrane and the signals disappear by membrane disruption. PMID: 23717684
  7. A rare ADRA1B haplotype composed of six single nucleotide polymorphism(SNP)s is associated with attention deficit hyperactivity disorder (ADHD). PMID: 23052569
  8. Noradrenaline facilitated cell proliferation by regulation of potassium currents in human osteoblasts via G(i/o) -protein-coupled alpha(1B) -adrenoceptors, not via coupling to Gq-proteins PMID: 23061915
  9. Through beta-D receptor heteromers dopamine inhibits adrenergic receptor signaling and blocks the synthesis of melatonin induced by adrenergic receptor ligands. PMID: 22723743
  10. Data show that sphingosine 1-phosphate can induce alpha1B-adrenergic receptor internalization and that its autocrine/paracrine generation is relevant for internalization induced by IGF-I. PMID: 22019450
  11. alpha1b and alpha2c AR is over-expressed in basal-like breast tumours of poor prognosis PMID: 21298476
  12. The mRNA expression of alpha1b-AR subtypes in bladder detrusor and posterior urethra was significantly lower in the inflammation group than in controls. PMID: 21223784
  13. A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation. PMID: 21224381
  14. These results are the first to demonstrate alpha1-ARs on human coronary ECs and indicate that the alpha1B subtype is predominant. PMID: 20857090
  15. the alpha(1B)-AR has differential effects on the phosphorylation status of the STAT3 pathway and may not be as prohypertrophic as the other two subtypes. PMID: 12695539
  16. heterodimerization with alpha1B-adrenergic receptors controls cell surface expression of alpha1D-adrenergic receptors PMID: 14736874
  17. the alpha(1B)-adrenoreceptor has a role in the inhibition of migration of human aortic smooth muscle cells PMID: 15220331
  18. alpha(1B)-adrenergic receptor expression causes a cell cycle progression and may induce transformation in sensitive cell lines. PMID: 15297446
  19. Human ureter was endowed with each alpha1 AR subtype, although alpha1D and alpha1A ARs were prevalent over alpha1B ARs PMID: 15690361
  20. These results indicate that the thio-acylation status of the alpha1b-adrenoceptor does not regulate G protein activation whereas thio-acylation of Galpha11 plays a key role in activation by the receptor. PMID: 16297597
  21. Ezrin directly interacts with the alpha1b-adrenergic receptor and plays a role in receptor recycling. PMID: 16352594
  22. the ADRA1B is able to form oligomeric rather than only simple dimeric complexes and disruption of effective oligomerization by introducing mutations into transmembrane domain IV has profound consequences for cell surface delivery and function PMID: 17220353
  23. alpha1B-ARs are the major alpha1-AR subtype expressed in DU145, PC3, and all TRAMP cell lines, but most of the receptor is localized in intracellular compartments in a nonfunctional state, which can be rescued upon prolonged incubation with any ligand. PMID: 17365508
  24. expression in distal ureter significantly higher than in proximal and mid ureter PMID: 17973108
  25. ADRA1B expression was increased in end stage renal disease. Functional receptor changes mediated vascular hypersensitivity to phenylephrine. PMID: 18257748
  26. Pharmacological profile of alpha 1B-adrenoceptors for ketanserin is strongly influenced by the assay conditions. PMID: 18336813
  27. These findings demonstrate differences in internalization between the alpha1a- and alpha1b-AR and provide evidence that the lack of significant endocytosis of the alpha1a-AR is linked to its poor interaction with beta-arrestins as well as with AP50. PMID: 18523139
  28. Functional alpha1- and beta2-adrenergic receptors in human osteoblasts. PMID: 19334040
  29. Report alpha1A and alpha1B subtypes are both present in human myocardium, but alpha1D binding is not, and the alpha1 subtypes are not downregulated in heart failure. PMID: 19919991

Show More

Hide All

Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Membrane, caveola. Note=Location at the nuclear membrane facilitates heterooligomerization and regulates ERK-mediated signaling in cardiac myocytes. signaling in cardiac myocytes. Colocalizes with GNAQ, PLCB1 as well as LAP2 at the nuclear membrane of cardiac myocytes.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1B sub-subfamily
Database Links

HGNC: 278

OMIM: 104220

KEGG: hsa:147

STRING: 9606.ENSP00000306662

UniGene: Hs.368632

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1