Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP)

Code CSB-CF846640HUb3
Abbreviation Recombinant Human ADTRP protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ADTRP
Uniprot No.
Research Area
others
Alternative Names
ADTRP; C6orf105; Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-230aa
Target Protein Sequence
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.8kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).
Gene References into Functions
  1. These data suggest that one molecular mechanism by which androgen confers protection against coronary artery disease is stimulation of ADTRP expression. PMID: 28645652
  2. ADTRP positively regulates PIK3R3 expression, which leads to activation of AKT and up-regulation of MIA3/TANGO1, thereby regulating endothelial cell functions directly relevant to atherosclerosis. PMID: 28341552
  3. ADTRP increases the number of S phase cells during cell cycle. PMID: 27235449
  4. These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism. PMID: 27018888
  5. association of ADTRP with the pathogenesis of early-onset CAD PMID: 26375920
  6. SNP rs6903956 associated with asymptomatic hyperuricemia susceptibility in Han Chinese PMID: 25928384
  7. Activation of PPARG increases the expression of C6ORF105 in human macrophages and atherosclerotic lesions. PMID: 25595457
  8. ADTRP polymorphism is associated with the development of coronary atherosclerosis. PMID: 24573017
  9. The single nucleotide polymorphism rs6903956 within the ADTRP gene on chromosome 6p24.1 is significantly associated with coronary artery disease in different ethnic groups of the Singaporean population. PMID: 23337689
  10. This study confirms ADTRP expression and colocalization with TFPI and caveolin-1 in endothelial cell. PMID: 21868574

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
AIG1 family
Tissue Specificity
Expressed in cultured endothelial cells and in placenta.
Database Links

HGNC: 21214

OMIM: 614348

KEGG: hsa:84830

UniGene: Hs.126409

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*