Recombinant Human Androgen-dependent TFPI-regulating protein(ADTRP)

Code CSB-CF846640HUb3
Size US$3276Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ADTRP
Uniprot No. Q96IZ2
Research Area others
Alternative Names ADTRP; C6orf105Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP; EC 3.1.-.-
Species Homo sapiens (Human)
Source in vitro E.coli expression system
Expression Region 1-230aa
Target Protein Sequence MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 46.8kDa
Protein Length Full Length
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).
Gene References into Functions
  1. These data suggest that one molecular mechanism by which androgen confers protection against coronary artery disease is stimulation of ADTRP expression. PMID: 28645652
  2. ADTRP positively regulates PIK3R3 expression, which leads to activation of AKT and up-regulation of MIA3/TANGO1, thereby regulating endothelial cell functions directly relevant to atherosclerosis. PMID: 28341552
  3. ADTRP increases the number of S phase cells during cell cycle. PMID: 27235449
  4. These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism. PMID: 27018888
  5. association of ADTRP with the pathogenesis of early-onset CAD PMID: 26375920
  6. SNP rs6903956 associated with asymptomatic hyperuricemia susceptibility in Han Chinese PMID: 25928384
  7. Activation of PPARG increases the expression of C6ORF105 in human macrophages and atherosclerotic lesions. PMID: 25595457
  8. ADTRP polymorphism is associated with the development of coronary atherosclerosis. PMID: 24573017
  9. The single nucleotide polymorphism rs6903956 within the ADTRP gene on chromosome 6p24.1 is significantly associated with coronary artery disease in different ethnic groups of the Singaporean population. PMID: 23337689
  10. This study confirms ADTRP expression and colocalization with TFPI and caveolin-1 in endothelial cell. PMID: 21868574

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families AIG1 family
Tissue Specificity Expressed in cultured endothelial cells and in placenta.
Database Links

HGNC: 21214

OMIM: 614348

KEGG: hsa:84830

UniGene: Hs.126409

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1