Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Code CSB-CF001625HU
Abbreviation Recombinant Human ALOX5AP protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-161aa
Target Protein Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Gene References into Functions
  1. Phosphate steering is an unappreciated FLAP function that enforces 5'-flap specificity and catalysis, preventing genomic instability. PMID: 28653660
  2. This meta-analysis indicates that ALOX5AP rs17222919-1316T/G may be a protective factor against stroke. PMID: 30313062
  3. No significant association was found between ALOX5AP rs10507391 polymorphism and ischemic stroke risk in males. Moreover, ALOX5AP rs10507391 polymorphism was not associated with cardioembolic ischemic stroke risk. PMID: 29096760
  4. rs17222919 of ALOX5AP is a potential genetic protective factor against ischemic stroke in the Chinese population PMID: 27416969
  5. The results the study indicate that SNP genetic variants of ALOX5AP might play a role in the development of SSc-related pulmonary fibrosis and ventilatory dysfunction. PMID: 28160477
  6. Meta-analysis suggests that the A allele at the ALOX5AP SG13S114 polymorphism is a protective factor for the ischemic stroke in the European population PMID: 28101761
  7. Genetic polymorphisms of T-1131C APOA5 and ALOX5AP SG13S114 can be considered risk factors for the susceptibility to ischemic stroke in Morocco. PMID: 27350673
  8. Data indicate that a single amino acid mutation was sufficient to reverse the speciation observed in wild type 5-Lipoxygenase activating protein (FLAP). PMID: 27129215
  9. No association was found between single-nucleotide polymorphisms of ALOX5AP or PDE4D and the risk of overall ischemic stroke in a southeastern Chinese population. The ALOX5AP gene might be related to ischemic stroke incidence in females. PMID: 24485247
  10. Genetic interaction of CD80 and ALOX5AP was observed in systemic lupus erythematosus in Asian populations. PMID: 25862617
  11. findings show that several enzymes known to be involved in the biosynthesis of proinflammatory LTs, such as FLAP and cPLA2alpha, also contribute to LX and Rv formation PMID: 26289316
  12. The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility PMID: 26159646
  13. results of the meta-analysis indicate that ALOX5AP rs10507391/SG13S114 A>T polymorphism is not associated with the risk of cerebral infarction in the Chinese population. PMID: 25242267
  14. Genetic polymorphisms of ALOX5AP and CYP3A5 increase susceptibility to ischemic stroke and are associated with atherothrombotic events in stroke patients. PMID: 25534367
  15. Our study provides evidence that the promoter single nucleotide polymorphism (SNP) rs17222919 of the ALOX5AP is a potential genetic protective factor for IS in the Chinese Han population. PMID: 25815512
  16. Report no association between ALOX5AP SNPs and atherosclerotic plaque phenotypes. PMID: 25721704
  17. FLAP protein inhibition attenuates inflammation induced by lipopolysaccharides (LPS) or the lipid A fraction of LPS. PMID: 25025775
  18. Rs10507391, rs4769874 and its haplotypes in ALOX5AP are unrelated to ACS risk in the Chinese Han population of Changwu, but elevated serum LTB4 level is strongly associated withacute coronary syndrome risk PMID: 25210744
  19. A common genetic variant SG13S114/AA in ALOX5AP was associated with ischemic stroke in Chinese cohort. PMID: 24198186
  20. BRP-7 potently suppresses leukotriene biosynthesis by interacting with FLAP in human neutrophils/monocytes. PMID: 24641614
  21. ALOX5AP polymorphisms are associated with atherosclerotic cerebral infarction in a cigarette smoking Chinese population. PMID: 24411318
  22. This study showed that interactions between the ALOX5AP SG13S114 and CYP3A5 A6986G genes can engender a significantly higher risk of stroke than a single risk factor. PMID: 24368493
  23. There was no statistically significant association of ALOX5AP rs4073259 SNP with ischemic stroke in this northeastern Chinese Han population living in Heilongjiang province, China. PMID: 24635928
  24. This meta-analysis identifies three polymorphisms of ALOX5AP that are significantly associated with risk for the Chinese population to develop ischemic stroke. PMID: 24183033
  25. a protective role of the three ALOX5AP SNPs for stroke PMID: 25010723
  26. The cellular biosynthesis of 5-LO products from endogenously derived substrate requires not only functional 5-LO/FLAP co-localization but also additional prerequisites which are dispensable when exogenous AA is supplied PMID: 24905297
  27. The roles of CLP and FLAP in in cellular leukotriene biosynthesis, were studied. PMID: 25034252
  28. The two genetic polymorphisms of ALOX5AP, SG13S114 and SG13S32, are not associated with cerebral infarction. PMID: 23546934
  29. The results of our study failed to confirm whether the selected variants in ALOX5AP gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA. PMID: 23828562
  30. ALOX5AP SG13S114 polymorphism is associated with susceptibility to ischemic stroke in Chinese population. [review] PMID: 24148560
  31. the interaction between ALOX5AP-SG13S114AA and COX-2-765CC apparently increases susceptibility to cerebral infarction. PMID: 23765972
  32. Genetic variability in FLAP and ALOX15 may modify the protective effect of NSAID use against colorectal neoplasia. PMID: 23404351
  33. Data indicate that single-nucleotide polymorphisms (SNPs) in 5-lipoxygenase activating protein (ALOX5AP), phosphodiesterase 4D (PDE4D), and interleukin-1alpha (IL-1alpha) were associated with an increased risk of atherothrombotic stroke (ATS) in Chinese. PMID: 23076369
  34. The ALOX5AP SNP A allele in rs4073259 and genotype rs9579646 GG, rs9551963 AC, and haplotype rs9315050 & rs9551963 AAAC were associated with an increased risk of ischemic stroke. PMID: 22849376
  35. SNP haplotypes with susceptibility to coronary artery disease in a Chinese Han population PMID: 22726381
  36. study is the first to demonstrate the association between lung function and ALOX5AP polymorphisms in a healthy and general population PMID: 22537113
  37. Our data do not support the hypothesis that variants in ALOX5AP are associated with risk of MRI-defined brain infarcts. PMID: 22074807
  38. This study provides preliminary evidence suggesting that genetic polymorphisms of ALOX5AP are associated with atherothrombotic stroke. PMID: 22051033
  39. ALOX5AP SNPs are unlikely to play a dominant role in the pathogenesis of abdominal aortic aneurysms. PMID: 22129473
  40. The polymorphisms spanning ALOX5AP is not major determinants of baseline lung function in smokers. PMID: 22206291
  41. Genetic variants in the promoter region of the ALOX5AP gene might be a novel genetic risk factor for ischemic stroke in a north Chinese Han population. PMID: 21893978
  42. These results suggested that the genetic variants in ALOX5AP might modulate the risk of stroke in Eastern Chinese Han population. PMID: 21153769
  43. A Promoter polymorphism (rs17222919, -1316T/G) of ALOX5AP is associated with intracerebral hemorrhage in Korean population PMID: 21816595
  44. No statistically significant associations were found between acute stroke and the ALOX5AP gene polymorphisms examined PMID: 21675249
  45. Polymorphisms of the 5-lipo-oxygenase-activating protein may be associated with chronic spontaneous urticaria. PMID: 21227888
  46. Data show that the HapB haplotype and rs1722842 polymorphism in ALOX5AP gene were associated with coronary heart disease, and the HapA haplotype was associated with risk of MI. PMID: 21199733
  47. The polymorphism of SG13S114A/T in ALOX5AP is not related with atherosclerotic cerebral infarction. PMID: 20014490
  48. LTA4H and ALOX5AP gene polymorphisms modify the augmentation of bronchodilator responsiveness by leukotriene modifiers in Puerto Ricans but not Mexicans with asthma. PMID: 20810156
  49. Our results support the role of LTA4H and ALOX5AP variants as risk factors for asthma in Latino populations. PMID: 20067482
  50. The ALOX5AP SG13S114 variant is an independent risk factor for ischemic stroke in the Iberian population and is associated with ALOX5AP expression levels PMID: 20357438

Show More

Hide All

Involvement in disease
Ischemic stroke (ISCHSTR)
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
MAPEG family
Database Links

HGNC: 436

OMIM: 601367

KEGG: hsa:241

STRING: 9606.ENSP00000369858

UniGene: Hs.507658

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*