Recombinant Human CD9 antigen(CD9)

Code CSB-CF004969HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P21926
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Source in vitro E.coli expression system
Gene Names CD9
Protein Names Recommended name: CD9 antigenAlternative name(s): 5H9 antigen Cell growth-inhibiting gene 2 protein Leukocyte antigen MIC3 Motility-related protein Short name= MRP-1 Tetraspanin-29 Short name= Tspan-29 p24 CD_antigen= CD9
Expression Region 2-228
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion.
Subcellular Location Membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families Tetraspanin (TM4SF) family
Tissue Specificity Detected in platelets (at protein level). Expressed by a variety of hematopoietic and epithelial cells.
Database Links

HGNC: 1709

OMIM: 143030

KEGG: hsa:928

STRING: 9606.ENSP00000009180

UniGene: Hs.114286

Pathway Hematopoietic cell lineage

Related Products

CD9 Antibodies

CD9 Antibodies for Homo sapiens (Human)

CD9 Antibodies for Human

CD9 Proteins

CD9 Proteins for Homo sapiens (Human)

CD9 ELISA Kit

CD9 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.