Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF004969HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P21926 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
| Source | in vitro E.coli expression system |
| Gene Names | CD9 |
| Protein Names | Recommended name: CD9 antigenAlternative name(s): 5H9 antigen Cell growth-inhibiting gene 2 protein Leukocyte antigen MIC3 Motility-related protein Short name= MRP-1 Tetraspanin-29 Short name= Tspan-29 p24 CD_antigen= CD9 |
| Expression Region | 2-228 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full Length of Mature Protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion. |
| Subcellular Location | Membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein |
| Protein Families | Tetraspanin (TM4SF) family |
| Tissue Specificity | Detected in platelets (at protein level). Expressed by a variety of hematopoietic and epithelial cells. |
| Database Links |
HGNC: 1709 OMIM: 143030 KEGG: hsa:928 STRING: 9606.ENSP00000009180 UniGene: Hs.114286 |
| Pathway | Hematopoietic cell lineage |
CD9 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004969KA01HU | CD9 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-RA004969A0HU | CD9 Antibody | Human | ELISA, WB, IHC, IF, FC |
| CSB-PA001486 | CD9 Antibody | Human,Mouse,Rat | WB,IHC,IF,ELISA |
CD9 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA10559A0Rb | CD9 Antibody | Human, Mouse | ELISA, WB, IHC, IF |
| CSB-PA10559B0Rb | CD9 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA10559C0Rb | CD9 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA10559D0Rb | CD9 Antibody, Biotin conjugated | Human | ELISA |
CD9 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP004969HU1 CSB-EP004969HU1 CSB-BP004969HU1 CSB-MP004969HU1 |
Recombinant Human CD9 antigen(CD9),partial | Yeast E.coli Baculovirus Mammalian cell |
CD9 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL004969HU | Human CD9 antigen(CD9) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 0.039 ng/mL |
-SDS.jpg)
Recombinant Human Bone sialoprotein 2 (IBSP),Partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Transcription factor PU.1(SPI1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human NADPH:adrenodoxin oxidoreductase, mitochondrial(FDXR)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Calcium-dependent phospholipase A2(PLA2G5)
Express system: Yeast
Species: Homo sapiens (Human)
-AC.jpg)
Recombinant Human Aquaporin-1(AQP1)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.