Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 3 (CMTM3)

Code CSB-CF836263HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CMTM3
Uniprot No.
Alternative Names
CMTM3; CKLFSF3; CKLF-like MARVEL transmembrane domain-containing protein 3; Chemokine-like factor superfamily member 3
Species
Homo sapiens (Human)
Expression Region
1-182
Target Protein Sequence
MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYV ASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFAISITA IAKYSDGASKAAGVFGFFATIVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSD SD
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. CMTM3 exhibited a lower expression pattern in gastric cancer tissues.MiR-135b-5p promotes gastric cancer progression by targeting CMTM3. PMID: 29345297
  2. this study demonstrates that knockdown of CMTM3 promotes the metastasis of gastric cancer through the STAT3/Twist1/EMT pathway PMID: 27121055
  3. CMTM3 was significantly hypermethylated in colorectal cancer tissues when compared with adjacent normal colorectal tissues. PMID: 28782576
  4. CMTM3 decreases EGFR expression, facilitates EGFR degradation, and inhibits the EGF-mediated tumorigenicity of gastric cancer cells by enhancing Rab5 activity. PMID: 27867015
  5. CMTM3 mediates cell-cell adhesion at adherens junctions and contributes to the control of vascular sprouting by regulation VE-cadherin turnover. PMID: 28428220
  6. Overexpression of CMTM3 attenuated the tumor growth of hepatocellular carcinoma. PMID: 27629543
  7. identified CMTM3 as a novel secretory protein released via exosomes in the prostate PMID: 27125975
  8. study indicates that elevated CMTM3 methylation is a risk factor in male LSCC patients, especially in the patients with age over 55years and with smoking behavior PMID: 27521994
  9. Reduced expression of CMTM3 is associated with prostate cancer. PMID: 25990505
  10. Low expression of CMTM3 was associated with metastasis and recurrence of oral squamous cell carcinoma. PMID: 25946973
  11. CMTM3 is significantly down-regulated in clear cell renal cell carcinoma and exerts remarkable tumor-suppressive functions PMID: 23907292
  12. Peritoneal disseminated metastases were significantly suppressed by CMTM3. PMID: 24131472
  13. CMTM3/CKLFSF3 is an evolutionarily conserved gene that may have important roles in the male reproductive system and immune system. PMID: 17002874
  14. CMTM3 inhibits prostate-specific antigen expression at both mRNA and protein levels with no obvious influence on androgen receptor expression. PMID: 18402773

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Chemokine-like factor family
Tissue Specificity
Expressed in the leukocytes, placenta and testis.
Database Links

HGNC: 19174

OMIM: 607886

KEGG: hsa:123920

STRING: 9606.ENSP00000354579

UniGene: Hs.298198

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1