Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 5 (CMTM5)

Code CSB-CF842660HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CMTM5
Uniprot No.
Alternative Names
CMTM5; CKLFSF5; CKLF-like MARVEL transmembrane domain-containing protein 5; Chemokine-like factor superfamily member 5
Species
Homo sapiens (Human)
Expression Region
1-223
Target Protein Sequence
MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM AAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPW PGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAV TSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Overexpression of CMTM5 attenuated vascular endothelial cells migration and proliferation. PMID: 28457985
  2. results indicate that CMTM5 is down-regulated in prostate cancer and exhibit tumor suppressor activities in androgen-independent prostate cancer cells PMID: 25387568
  3. In the OSCC cell lines CAL27 and GNM, the ectopic expression of CMTM5-v1 strongly inhibited cell proliferation and migration and induced apoptosis. PMID: 24721428
  4. The reduced expression of CMTM5 correlates significantly with poorly differentiated ovarian cancer and high preoperative CA125 level. PMID: 21841490
  5. Data suggest that CMTM5 may be involved in the pathomechanism of myeloid leukemias. PMID: 21168207
  6. The expression level of cmtm5 gene is abnormally lower in the bone marrow cells from the multiple myeloma patients, and are associated with ISS stages. PMID: 20416169
  7. HER2 was up regulated in prostate cancer epithelium while CMTM5 was down regulated. Overexpression of CMTM5 in PC3 cells could lower the HER2 and Cyclin D1 protein level. PMID: 20721248
  8. CMTM5-v1 might be secreted via a different vesicle-mediated secretory pathway, which will be helpful for the studies of vesicle-mediated secretion and MARVEL domain-containing proteins. PMID: 20356458
  9. CMTM5 exhibits tumor suppressor activities, but with frequent epigenetic inactivation in carcinoma cell lines PMID: 17908965
  10. These findings verify that CMTM5-v1 inhibits the growth of CC cell lines via inducing apoptosis. PMID: 19124004
  11. CMTM5 may play a role in the pancreatic cancer. PMID: 19577543

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Chemokine-like factor family
Tissue Specificity
Highly expressed in the brain.
Database Links

HGNC: 19176

OMIM: 607888

KEGG: hsa:116173

STRING: 9606.ENSP00000352270

UniGene: Hs.99272

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1