Recombinant Human Calcium release-activated calcium channel protein 1 (ORAI1)

Code CSB-CF846601HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ORAI1
Uniprot No.
Alternative Names
ORAI1; CRACM1; TMEM142A; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A
Species
Homo sapiens (Human)
Expression Region
1-301
Target Protein Sequence
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY A
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT. Plays a prominent role in Ca(2+) influx at the basolateral membrane of mammary epithelial cells independently of the Ca(2+) content of endoplasmic reticulum or Golgi stores. May mediate transepithelial transport of large quantities of Ca(2+) for milk secretion.
Gene References into Functions
  1. this study demonstrates that ORAI1 gene SNPs rs12320939 and rs3741596 are associated with the risk of chronic spontaneous urticaria PMID: 27864023
  2. Pore helix rotation by stromal interaction molecule 1 (STIM1) indicates the dynamic coupling between CRAC channel Orai1 gating and ion selectivity. PMID: 28220789
  3. discovered that it was not the N termini, but the loop2 regions connecting TM2 and TM3 of Orai1 and Orai3 that featured distinct properties, which explained the different, isoform-specific behavior of Orai N-truncation mutants. PMID: 29237733
  4. the conserved portion of the Orai N terminus is essential for STIM1, as it fine-tunes the open Orai channel gating, thereby establishing authentic CRAC channel activity. PMID: 29237734
  5. The constitutive activation of Orai1 in Stormorken syndrome mainly involves the CRAC-activating domain CAD/SOAR of STIM1, the exposure of which is regulated by the molecular interplay between three cytosolic STIM1 coiled-coil (CC) domains. PMID: 29483506
  6. Study proposes that BPIFA1 (SPLUNC1) is the epithelium-derived smooth muscle relaxing factor and it functions by internalizing Orai1. BPIFA1 deficiency in asthmatic airways promotes Orai1 hyperactivity, increased airway smooth muscle contraction and airway hyperresponsiveness. PMID: 28165446
  7. Each STIM1 protein monomer within the dimer interacts independently with single Orai1 subunits to mediate cross-linking between Orai1 channels. PMID: 29581306
  8. Results show that ORAI1 binding to STIM1 requires Y361 phosphorylation of STIM1 by PYK2. PMID: 28218251
  9. These data suggest that zinc may inhibit cell proliferation of esophageal cancer cells through Orai1-mediated intracellular Ca(2+) oscillations and reveal a possible molecular basis for zinc-induced cancer prevention and Orai1-SOCE signaling pathway in cancer cells. PMID: 28928244
  10. Hypoxia-induced upregulation of Orai1 drives colon cancer invasiveness and angiogenesis PMID: 29753044
  11. Subsequent studies showed that, like the CRAC channels, the ARC channels were also formed byOrai proteins but, whilst Orai1 formed the CRAC channel, the ARCchannel was a heteromeric assembly of Orai1 and Orai3 proteins PMID: 27847114
  12. the declined Orai1 expression, at least partly, contributes to the downregulated Ca(2+) entry during lymphocyte excitation, providing an important mechanism for T lymphocyte malfunction in diabetes. PMID: 29654766
  13. An Orai1 C-terminal STIM1-binding site, situated far from the N-terminal pore helix, alone provides the trigger that is necessary and sufficient for channel gating. PMID: 27929067
  14. Orai1 silencing also reduced cell viability, caused cell apoptosis and cell cycle arrest in Multiple myeloma cell lines. PMID: 30114708
  15. Studied the conformation and functional physiology of human calcium release-activated calcium modulator 1 (Orai1) in calcium channel gating. PMID: 29760086
  16. Study shows that STIM1 and ORAI1 promotes membrane ruffling by showing that phospho-STIM1 localizes at the leading edge of cells, and that both phospho-STIM1 and ORAI1 co-localize with cortactin. PMID: 28341841
  17. These results demonstrate that spontaneous and self-peptide major histocompatibility complex-dependent activation of Orai1 ensures random walk behavior in T cells to optimize immune surveillance. PMID: 29239723
  18. Store-operated calcium entry (SOCE), a unique plasma membrane Ca(2+) entry mechanism, is activated when ER-[Ca(2+)] is decreased. SOCE is mediated via the primary channel, Orai1, as well as others such as TRPC1. PMID: 29594865
  19. Orai1 and miR-93 significantly impact on the progression of TGF-beta1-mediated EMT and fibrogenesis in HK2 cells PMID: 29551286
  20. In patients with ORAI1 and STIM1 loss of function mutations, effector functions were preserved in polymorphonuclear neutrophils. PMID: 26670474
  21. A cluster of Orai1 mutations was identified. The cancer- and myopathy-related mutations trigger Ca(2+) permeation associated with gene transcription and provide a gating mechanism for Orai1. PMID: 29184031
  22. the functional coupling between SPCA1 and Orai1 increases cytosolic and intraluminal Ca(2+) levels, representing a novel mechanism of store-independent Ca(2+) entry that may be affected in Hailey-Hailey disease. PMID: 29555205
  23. results revealed a novel role of Orai1 as an inducer of aggression and angiogenesis under hypoxic conditions, and this suggests a novel mechanism of hypoxia-induced invasion. PMID: 29307746
  24. These results demonstrate a novel mechanistic model for ROS-mediated inhibition of Orai1 and identify a candidate residue for pharmaceutical intervention. PMID: 27624281
  25. Results show that Orai1 is activated through its binding to STIM1. the complex ORAI1-STIM1 regulates cholesterol. PMID: 27459950
  26. calmodulin (CaM) associates with the core region of STIM1 in a Ca2+-dependent manner. Consequently, calcium-bound CaM disrupts the STIM1-Orai1 complex and disassembles STIM1 oligomers, thereby inducing deactivation of the store-operated calcium entry. PMID: 29051492
  27. Here, we summarize the recent discoveries on the structure-function relationship of Orai1, as well as its interaction with the native channel opener STIM1 and chemical modulator 2-aminoethoxydiphenyl borate . PMID: 27753099
  28. Orai3 is associated with poor prognosis of lung adenocarcinoma, predicting metastasis and reduced survival. PMID: 27835593
  29. These results not only highlight the complex effect of cholesterol regulation on SOCE, but also indicate a direct regulatory effect on Orai1 localization and compartmentalization by this lipid. PMID: 28919480
  30. Data show that the G98S and V107M mutations generate constitutively permeable ORAI1 channels, whereas T184M alters the channel permeability only in the presence of STIM1. PMID: 28058752
  31. Data indicate that the inhibition of the Store Operated Calcium Entry (SOCE)-dependent colon cancer cell migration through SK3/TRPC1/Orai1 channel complex by the alkyl-lipid Ohmline may be a strategy to modulate Anti-EGFR mAb action in metastatic colorectal cancer (mCRC). PMID: 27102434
  32. Study identifies Orai1 as a novel molecular determinant for oral/oropharyngeal squamous cell carcinoma progression by enhancing cancer stemness. PMID: 27259269
  33. Healthy individuals and patients with urolithiasis in the Russian population who have the GG genotype and/or the G allele of the polymorphism of the ORAI1 gene (rs7135617) represent risk groups for the formation of calcium oxalate stones. PMID: 28845932
  34. Orai1 expression is a predictor of 5-Fluorouracil sensitivity for hepatocarcinoma treatment. PMID: 27878958
  35. Store-operated calcium entry via Orai1 in mesangial cells negatively regulates the TGF-beta1/Smad3 signaling pathway. PMID: 28637791
  36. F. vulgare fruits extract and its hexane fraction strongly blocked ORAI1 currents and tyrosinase activity and significantly inhibited UV-induced melanogenesis PMID: 27712859
  37. Aptamer Y1 binds to Orai1 and inhibits Ca2+ influx into antigen-activated mast cells PMID: 27390850
  38. Elevated Orai1 and STIM1 expressions upregulate MACC1 expression to promote tumor cell proliferation, metabolism, migration, and invasion in human gastric cancer. PMID: 27431311
  39. Orai1 expression was higher in colorectal cancer (CRC) tissues than adjacent non-cancerous tissues; increased expression of Orai1 was observed in invasive CRC cell lines and ectopic expression of Orai1 enhanced cell proliferation and inhibited apoptosis; the Akt/GSK3beta pathway contributed to Orai1 effects in CRC cells, and Orai1 was a direct target of miR-519 PMID: 26792278
  40. CRAC channel functions as a hexamer of Orai1 subunits PMID: 27806271
  41. A novel heterozygous c.290C>G (p.S97C) mutation in ORAI1 causing a mild- and late-onset tubular aggregate myopathy and congenital miosis via constitutive activation of the CRAC channel. PMID: 27882542
  42. The focus is on the activation of the STIM proteins, the subsequent coupling of STIM1 to Orai1, and the consequent structural rearrangements that gate the Orai channels into the open state to allow Ca(2+)permeation into the cell. [review] PMID: 26825122
  43. results argue strongly against a tetrameric configuration for Orai1 channels and indicate that the Orai1 channel functions as a hexamer. PMID: 27780862
  44. APP does not modulate Orai-dependent store-operated calcium entry following quantitative calcium store depletion. PMID: 27526994
  45. Orai1 regulates osteogenic differentiation through BMP signaling, and the Orai1-BMP signaling may be a possible therapeutic target for treating bone-related diseases. PMID: 27086849
  46. Orai1-mediated Ca(2+)-influx and SPCA2-mediated Ca(2+) uptake activity into the Golgi/secretory pathway might be coupled possibly in a microdomain. This channel/pump complex may efficiently transfer Ca(2+) into the secretory pathway, which might play a role in SPCA2-expressing secretory cells, such as mammary gland during lactation. PMID: 27692665
  47. This study may lay the foundation for finding novel lead compounds for clinical trials that could positively modulate the course of autoimmune disorders with ORAI1 as its specific target. PMID: 26895524
  48. Mutations in the STIM1 and ORAI1 genes cause calcium dyshomeostasis in tubular aggregate myopathy. (Review) PMID: 27879676
  49. Results revealed that Orai1-mediated store-operated Ca(2+) entry is critical for gastrointestinal stromal tumor cell proliferation via c-KIT and ERK signaling pathway activation. PMID: 28231736
  50. SARAF overexpression attenuated store operated Ca2+ entry and the STIM1-Orai1 interaction in cells endogenously expressing STIM1 and Orai1 while RNAi-mediated SARAF silencing induced opposite effects. PMID: 27068144

Show More

Hide All

Involvement in disease
Immunodeficiency 9 (IMD9); Myopathy, tubular aggregate, 2 (TAM2)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families
Orai family
Tissue Specificity
Expressed in naive CD4 and CD8 T cells (at protein level). Expressed at similar levels in naive and effector T helper cells.
Database Links

HGNC: 25896

OMIM: 610277

KEGG: hsa:84876

STRING: 9606.ENSP00000328216

UniGene: Hs.55148

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1