Recombinant Human Cardiolipin synthase (CRLS1)

Code CSB-CF890725HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CRLS1
Uniprot No.
Alternative Names
CRLS1; C20orf155; CLS1; Cardiolipin synthase; CMP-forming; CLS; Protein GCD10 homolog
Species
Homo sapiens (Human)
Expression Region
1-301
Target Protein Sequence
MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRL PGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGL APVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISIL YVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTF ISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIK D
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a key phospholipid in mitochondrial membranes and plays important roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stress conditions.
Gene References into Functions
  1. Knockdown of human CRLS1 leads to a cardiolipin decrease, phosphatidylglycerol accumulation and mitochondrial elongation. PMID: 29251771
  2. transgenic expression of cardiolipin synthase attenuated maladaptive cardiolipin remodeling and bioenergetic inefficiency in myocardium rendered diabetic by streptozotocin treatment. PMID: 22584571
  3. CLS mRNA levels cannot be correlated with CLS enzyme activity nor CL content in the LPS model of inflammation. PMID: 20652826
  4. A human candidate gene/cDNA for cardiolipin synthase, C20orf155, was identified. PMID: 16678169
  5. hCLS1 protein was localized to the mitochondria when transiently expressed in COS-7 cells PMID: 16716149
  6. We describe here a human gene for CLS and its analysis via RNAi knockdown on apoptotic progression. PMID: 16888643
  7. anti-cardiolipin antibody positivity is an independent predictor of chronic renal failure PMID: 19048414
  8. Patients with solid and non-solid malignancies display anticardiolipin antibodies associated with increased rate of thrombosis PMID: 19048416
  9. presence of cardiolipin autoantibodies is criteria for diagnostics of antiphospholipid syndrome PMID: 19052923
  10. associated with Libman-Sacks endocarditis, cardiac manifestation of SLE PMID: 19089657
  11. antibodies occur frequently in viral infections, particularly, in HIV but not in bacterial infections PMID: 19089659

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Tissue Specificity
Highly expressed in tissues such as heart, skeletal muscle and liver.
Database Links

HGNC: 16148

OMIM: 608188

KEGG: hsa:54675

STRING: 9606.ENSP00000368140

UniGene: Hs.743956

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×