Recombinant Human Chemokine-like factor (CKLF)

Code CSB-CF005458HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CKLF
Uniprot No.
Alternative Names
CKLF; CKLF1; HSPC224; UNQ410/PRO772; Chemokine-like factor; C32
Species
Homo sapiens (Human)
Expression Region
1-152
Target Protein Sequence
MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFI LLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVC CLADGALIYRKLLFNPSGPYQKKPVHEKKEVL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play an important role in inflammation and regeneration of skeletal muscle. Partly inhibited by interleukin 10.; has chemotactic response in monocytes, neutrophils and lymphocytes. Binds CCR4.
Gene References into Functions
  1. Data indicate that leukocyte-infiltrate derived chemokine-like factor (CKLF) expression is a candidate biomarker of favorable prognosis. PMID: 27153559
  2. CKLF1 expression was up-regulated in synovim from rheumatoid arthritis and ankylosing spondylitis patients. PMID: 26838743
  3. expression elevated in the skin of keloid patients PMID: 26986142
  4. role in the pathogenesis of psoriasis by promoting the proliferation of microvascular endothelial cells PMID: 25915746
  5. Chemokine-like factor 1 is over-expressed in patients with atopic dermatitis. PMID: 23983609
  6. CKLF1 can induce proliferation and inhibit apoptosis of human vascular smooth muscle cell through the down-regulation of Bax and Caspase-3 and the up-regulation of Bcl-2 expression. PMID: 23253812
  7. The expression of CKLF1 is up-regulated in atherosclerotic plaques. PMID: 20137403
  8. CKLF1-C19 and -C27 can stimulate antigen-presenting capability of dendritic cells PMID: 20392439
  9. CKLF1 could increase the proliferation of human bone marrow hematopoietic progenitor cells and colony formation PMID: 12411060
  10. Results confirm that the secreted peptides of CKLF1, C27 and C19, have functional activation via CCR4. PMID: 18069042
  11. Chemokine-like factor expression is differentially regulated in myoblasts and myotubes and thrombin could be a strong regulator for its expression PMID: 18294340

Show More

Hide All

Subcellular Location
[Isoform 1]: Secreted.; [Isoform 2]: Membrane; Multi-pass membrane protein.; [Isoform 4]: Membrane; Multi-pass membrane protein.
Protein Families
Chemokine-like factor family
Tissue Specificity
Isoform 1, isoform 2, isoform 3 and isoform 4 have highest expression levels in adult spleen, lung, testis, ovary, peripheral blood leukocyte, placenta, pancreas, and in fetal brain, skeletal muscle, thymus and heart. Lower expression levels in adult skel
Database Links

HGNC: 13253

OMIM: 616074

KEGG: hsa:51192

STRING: 9606.ENSP00000264001

UniGene: Hs.15159

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1