Recombinant Human Cleft lip and palate transmembrane protein 1-like protein(CLPTM1L)

Code CSB-CF850323HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96KA5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTT TRSHLGAENNIDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHD GKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMA DNFVFDGSSLPADVHRYMKMIQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVS YDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLF DFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIE LWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSL LNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDD VFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD
Source in vitro E.coli expression system
Gene Names CLPTM1L
Protein Names Recommended name: Cleft lip and palate transmembrane protein 1-like protein Short name= CLPTM1-like protein Alternative name(s): Cisplatin resistance-related protein 9 Short name= CRR9p
Expression Region 1-538
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Enhances cisplatin-mediated apoptosis, when overexpressed.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families CLPTM1 family
Database Links

HGNC: 24308

OMIM: 612585

KEGG: hsa:81037

STRING: 9606.ENSP00000313854

UniGene: Hs.444673

Related Products

CLPTM1L Antibodies

CLPTM1L Antibodies for Homo sapiens (Human)

CLPTM1L Antibodies for Human

CLPTM1L Proteins

CLPTM1L Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.