Recombinant Human Cytochrome b reductase 1 (CYBRD1)

Code CSB-CF006326HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CYBRD1
Uniprot No.
Alternative Names
CYBRD1; DCYTB; FRRS3; Plasma membrane ascorbate-dependent reductase CYBRD1; Cytochrome b reductase 1; Duodenal cytochrome b; Ferric-chelate reductase 3
Species
Homo sapiens (Human)
Expression Region
1-286
Target Protein Sequence
MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVF IQGIAIIVYRLPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLH SWVGLIAVICYLLQLLSGFSVFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTE KLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGG TEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plasma membrane reductase that uses cytoplasmic ascorbate as an electron donor to reduce extracellular Fe(3+) into Fe(2+). Probably functions in dietary iron absorption at the brush border of duodenal enterocytes by producing Fe(2+), the divalent form of iron that can be transported into enterocytes. It is also able to reduce extracellular monodehydro-L-ascorbate and may be involved in extracellular ascorbate regeneration by erythrocytes in blood. May also act as a ferrireductase in airway epithelial cells. May also function as a cupric transmembrane reductase.
Gene References into Functions
  1. Single nucleotide polymorphism in CYBRD1 gene is associated with hemochromatosis. PMID: 28937159
  2. CYBRD1 has an involvement in iron homeostasis in chronic hepatitis C. PMID: 27439017
  3. DCYTB is an important predictor of outcome and is associated with response to therapy in breast cancer patients. PMID: 28270217
  4. Polymorphisms in CYBRD1 modulates iron phenotype in HFE p.C282Y homozygous hemochromatosis. PMID: 22773607
  5. Letter: report mutations in CYBRD1 promoter in and possible role in iron hemostasis in patients with porphyria cutanea tarda. PMID: 23012398
  6. In Africans with iron overload not related to the HFE gene, the possible involvement of the SLC40A1 and CYBRD1 genes was demonstrated for the first time. PMID: 15338274
  7. Duodenal cytochrome b present in human erythrocytes may contribute to their ability to reduce extracellular monodehydroascorbate. PMID: 17068337
  8. The current study concerns the recombinant expression, purification, and initial spectroscopic characterization of a recombinant form of the human ferric reductase. PMID: 18092813
  9. Functional characterization of Cybrd1 heme groups and iron/ascorbate metabolism. PMID: 18194661
  10. The results of this study confirm that Dcytb can act as a ferric reductase that stimulates iron uptake in Caco-2 cells. PMID: 18492824

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Present in erythrocyte membranes (at protein level). Also expressed in respiratory epithelium.
Database Links

HGNC: 20797

OMIM: 605745

KEGG: hsa:79901

STRING: 9606.ENSP00000319141

UniGene: Hs.221941

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×