Recombinant Human D (3) dopamine receptor (DRD3)

Code CSB-CF007180HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
DRD3; D(3 dopamine receptor; Dopamine D3 receptor
Species
Homo sapiens (Human)
Expression Region
1-400
Target Protein Sequence
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
Gene References into Functions
  1. This study showed that the DRD3 is a potential genetic factor in the susceptibility to amphetamine dependence and is associated with onset age of drug use through interaction with novelty seeking in a specific patient group in the Han Chinese population. PMID: 28028606
  2. The C allele of DRD3 rs6280 SNP was associated with increased risk of sleep bruxism (p = 0.02). PMID: 28451935
  3. Associations between 4 polymorphisms (rs11721264, rs3773678, rs167771, rs324035) and Parkinson's diseasehave been found. PMID: 27240184
  4. This study adds to the growing evidence on the association of single- and multiple-risk variants in DRD3, DRD4, and FEV with aggressive behavior in Chinese adolescents. PMID: 28846959
  5. SNPs (rs9880168) of the DRD3 were associated with Essential Hypertension in Hani nationality However, none SNPs of DRD1 and DRD3 of best models showed association with Essential Hypertension in Han and Yi nationality. PMID: 28579604
  6. Lowering the level of cellular FLNA caused an elevation in RalA activity and resulted in selective interference with the normal intracellular trafficking and signaling of D3R through beta-arrestins. Knockdown of FLNA or coexpression of active RalA prevented D3R from coupling with G protein. PMID: 27188791
  7. This study reveled that R D3 are upregulated in peripheral blood mononuclear cells in patient with multiple sclerosis. PMID: 27609280
  8. Study performed docking essays using risperidone and the D3 receptor crystallographic data and results suggested two possible distinct orientations for risperidone at the binding pocket; data highlight important hot spots in the DRD3 binding site bringing relevant information for the development of novel/derivative agents with atypical profile. PMID: 27434874
  9. Applying an external electric field, at different frequencies, in the logarithmic scale along the z-direction on the dopamine-dopamine receptor D3 complex, at some frequencies has a significant effect on salt bridge interaction and the structural observables, although it does not have any systematic or predictable effect on the dynamical and physical property of the protein. PMID: 27832207
  10. The results of this study suggest that genotype in DRD3 Ser9Gly was the main factor determining different doses of DAs and PD patients carrying Gly/Gly genotype require higher doses of pramipexole for effective treatment. PMID: 27817855
  11. Clathrin-mediated internalization of dopamine receptor D3 was responsible for lysosomal degradation. PMID: 27240955
  12. DRD3 Ser9Gly polymorphism is nominally associated with changes in triglycerides and metabolic syndrome after 12 weeks of standard BDII treatment. PMID: 27310943
  13. Regarding the DRD3 Ser9Gly polymorphism, individuals with a greater number of the Gly alleles, which are related to an increased dopamine release in the striatum, were more susceptible to social influence. PMID: 27784028
  14. DRD3 gene expression reduction in breast cancer patients after spiritual intervention PMID: 26597879
  15. This study showed a lack of association between of DRD3 rs6280 with the risk for essential tremor. PMID: 27456607
  16. The combination of MTHFR, DRD3 and MDR1 polymorphisms associated with a slow ATV metabolizer phenotype PMID: 26857559
  17. The DRD3 (rs6280) polymorphism influences younger Parkinson disease age of onset in the US Caucasian population. PMID: 26627941
  18. A significant positive correlation was found between the DRD3 mRNA level and the score of the excited factor in patients with schizophrenia/schizophreniform disorder. PMID: 26561806
  19. Ammonia induced autophagy by MTOR is mediated by DRD3. PMID: 27077655
  20. Drd3 palmitoylation acts as a molecular switch for Drd3-biased signaling via a GIPC1-dependent route, which is likely to affect the mode of action of antipsychotic drugs. PMID: 26787837
  21. used site-directed mutagenesis to identify key residues involved in D3 receptor signaling function PMID: 26116441
  22. Review concludes that striatum abnormalities in autism are associated with repetitive and stereotyped behavior in autism and may be related to DRD3 polymorphisms PMID: 25224105
  23. Study found a significant association with disordered gambling and rs167771 (DRD3) and with rs381572 (CAMK2D) in humans PMID: 25266122
  24. We did not find evidence of association between the other four SNPs (rs167771 and rs324029 in DRD3, rs8076005 and rs2066713 in SCL6A4) and Type 2 Diabetes Mellitus. PMID: 25927430
  25. relationship between DRD3 gene SNPs, striatum and stereotyped behavior in autism spectrum disorder PMID: 25792691
  26. An interaction between BDNF and DRD3 may not play a major role in the risk for suicide attempt. PMID: 25264289
  27. Results show significant association between a variant downstream of DRD3 and a co-morbid major depressive disorder-nicotine dependence phenotype. PMID: 24927283
  28. In people with diffuse Lewy body disease, Dopamine D receptor density was significantly increased in the striatal regions including caudate, putamen and nucleus accumbens. PMID: 23732230
  29. Findings provide no evidence for an association between DRD3 gene rs6280 and TS in the Han Chinese population. PMID: 25698199
  30. results provide insights into the potential contribution of molecules of cholesterol to the overall organization and potential stability of the D3 receptor and possibly other GPCR quaternary structures PMID: 25931118
  31. The DRD3 gene body hypermethylation was significantly associated with risk of schizophrenia. PMID: 25262640
  32. the results of this study provide initial evidence that polymorphisms in DRD3, perhaps reflecting a single risk locus, may be associated with lifetime post-traumatic stress disorder diagnosis. PMID: 25158632
  33. findings of this study suggest that the Dopamine D3 receptor rs6280 polymorphism is associated with the development of Alcohol Dependence in Koreans. PMID: 24776816
  34. DRD3 is possibly a genetic factor in the development of early-onset heroin dependence, but is not associated with specific personality traits. PMID: 24398431
  35. [review] In addition to its expression and signaling patterns, alterations in D3 receptor expression patterns following drug exposure suggest an important role for D3 signaling in the development of addiction. PMID: 24484980
  36. In contrast to a D2 receptor deficiency, cocaine dependent individuals may have heightened D3 receptor levels which could contribute to addiction-relevant traits. PMID: 23921256
  37. Dopamine D3 release is increased in dopamine (DRD)2 receptor-rich striatum and DRD3-rich extra-striatal regions in response to smoking. PMID: 23954846
  38. Pharmacological sequestration is correlated with desensitization of the D3 receptor in a Gbetagamma- and beta-arrestin-dependent manner. PMID: 23992580
  39. the present meta-analysis does not support the notion that the DRD3 Ser9Gly variant is a genetic risk factor for essential tremor. PMID: 24054403
  40. psychiatric phenotypes of the BDNF Met666Val and DRD3 Ser9Gly polymorphisms in bipolar disorder comorbid with anxiety disorder PMID: 24021960
  41. This study showed that Eight SNPs were nominally associated with SZ in either case-control or family based analyses (p < 0.05, rs7631540 and rs2046496 in DRD3. PMID: 23932573
  42. data demonstrate a crucial role for the dynamic interaction between D3R and USP48 in the regulation of NHE3 expression and function PMID: 24308971
  43. Significant associations were found between single nucleotide polymorphisms in the DRD3 gene and the pharmacokinetics of lopinavir/ritonavir during treatment of HIV infection. PMID: 24001122
  44. Data suggest that dopamine D3 receptors (DRD3) are associated with cognitive function in both healthy individuals and those with neuropsychiatric disorders characterized by cognition defects; DRD3 antagonists may improve cognitive function. [REVIEW] PMID: 23791072
  45. The present study suggests some impact of DRD3 gene variation on ECT response, potentially mediated by alteration of striatal engagement during the processing of emotionally rewarding stimuli. PMID: 22093107
  46. Selective inhibition of dopamine D3 brain receptors in smokers alleviates craving in smokers after overnight abstinence. PMID: 22968817
  47. Cortical dopamine D2/3 receptor function is more involved in some cognitive functions in patients with schizophrenia compared to controls. PMID: 22338593
  48. The rs6280 single nucleotide polymorphism is not related to risk for restless legs syndrome. PMID: 23312624
  49. This study provided information regarding the influence of Ser9Gly Polymorphism of the D3 Receptor on long-term forgetting of episodic information. PMID: 23363412
  50. Allelic association between schizophrenia and the DRD3 rs6280 polymorphism was found, but it did not survive correction for multiple testing. PMID: 22940547

Show More

Hide All

Involvement in disease
Tremor, hereditary essential 1 (ETM1); Schizophrenia (SCZD)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Both membrane-bound and scattered in the cytoplasm during basal conditions. Receptor stimulation results in the rapid internalization and sequestration of the receptors at the perinuclear area (5 and 15 minutes), followed by the dispersal of the receptors to the membrane (30 minutes). DRD3 and GRK4 co-localize in lipid rafts of renal proximal tubule cells.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain.
Database Links

HGNC: 3024

OMIM: 126451

KEGG: hsa:1814

STRING: 9606.ENSP00000373169

UniGene: Hs.121478

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1