Recombinant Human DNA damage-regulated autophagy modulator protein 1 (DRAM1)

Code CSB-CF836675HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
DRAM1; DRAM; DNA damage-regulated autophagy modulator protein 1; Damage-regulated autophagy modulator
Species
Homo sapiens (Human)
Expression Region
1-238
Target Protein Sequence
MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMI NFSAFLGAATMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPV VHDGGALLAFVCGVVYTLLQSIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASL ISITKLEWNPREKDYVYHVVSAICEWTVAFGFIFYFLTFIQDFQSVTLRISTEINGDI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lysosomal modulator of autophagy that plays a central role in p53/TP53-mediated apoptosis. Not involved in p73/TP73-mediated autophagy.
Gene References into Functions
  1. Altogether, these findings suggest that in normal/high glucose condition a mutual unbalance between p53-dependent apoptosis (PUMA) and autophagy (DRAM) gene occurred, modifying the ADR-induced cancer cell death in HG both in vitro and in vivo. PMID: 28893313
  2. Overexpression of full-length AIFM1 suppresses proliferation and induces apoptosis of HepG2 and Hep3B cells. Caspase 3 and DRAM are involved in full-length AIFM1-induced apoptosis in HepG2 and Hep3B cells. PMID: 29501488
  3. DRAM1 regulates apoptosis by inhibiting BAX degradation. PMID: 25633293
  4. DRAM1 mediates autophagic defense against a broader range of intracellular pathogens, since DRAM1 expression was also induced by the common bacterial endotoxin lipopolysaccharide. PMID: 24922577
  5. Suggest that promoting DRAM-mediated autophagy together with PI3K/AKT inhibition might be more effective for autophagy-based therapy in hepatoma. PMID: 24556693
  6. DRAM is an important gene for the enhancement of p53-dependent apoptosis. PMID: 24133622
  7. DRAM1 affects autophagy through lysosomal acidification, fusion of lysosomes with autophagosomes and clearance of autophagosomes. PMID: 23696801
  8. DRAM gene expression is down regulated by oxidative stress through the mediation of reactive oxygen species PMID: 23832602
  9. DRAM triggers lysosomal membrane permeabilization and cell death in CD4(+) T cells infected with HIV. PMID: 23658518
  10. these findings shed new light on the role of autophagy in GBM and reveal a novel function of the autophagy regulators DRAM1 and p62 in control of migration/invasion in cancer stem cells. PMID: 22525272
  11. Overexpression of miR-199a-5p inhibits DRAM1 and Beclin1 expression. PMID: 23337876
  12. p73-regulated DRAM-1 is functionally involved in neutrophil differentiation of acute promyelocytic leukemia cells. PMID: 22981223
  13. DRAM-1 encodes not just one mRNA, but a series of p53-inducible splice variants which are expressed at varying levels in multiple human and mouse cell lines. PMID: 22082963
  14. Overexpression of DRAM induces VRK1 downregulation and the opposite effect was observed by its knockdown. PMID: 21386980
  15. Collectively therefore, these studies not only report a stress-induced regulator of autophagy but also highlight the relationship of DRAM and autophagy to p53 function and damage-induced programmed cell death. PMID: 16839881
  16. DRAM links autophagy to p53 and programmed cell death. PMID: 17102582
  17. identified FLJ11259/DRAM as a p53-inducible member of a novel family of transmembrane proteins. FLJ11259/DRAM may be an important modulator of p53 responses in diverse tumor types. PMID: 17397945
  18. DRAM is activated by p53 which is required for the ability of p53 to induce autophagy and is also critical for the ability of p53 to induce programmed cell death. PMID: 19556885
  19. c-Jun NH2-terminal kinase as a novel mediator of DRAM protein regulation in Ewing sarcoma cells PMID: 19706754

Show More

Hide All

Subcellular Location
Lysosome membrane; Multi-pass membrane protein.
Protein Families
DRAM/TMEM150 family
Database Links

HGNC: 25645

OMIM: 610776

KEGG: hsa:55332

STRING: 9606.ENSP00000258534

UniGene: Hs.525634

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1