Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23)

Code CSB-CF001285HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ADAM23
Uniprot No.
Alternative Names
ADAM23; MDC3; Disintegrin and metalloproteinase domain-containing protein 23; ADAM 23; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3; MDC-3
Species
Homo sapiens (Human)
Expression Region
287-832
Target Protein Sequence
AVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.
Gene References into Functions
  1. The relationships between the decreased methylation levels of the SNAI2 and ADAM23 genes and cancer de-differentiation and haematogenous dissemination, respectively, indicate novel functions of those genes in the invasive processes. PMID: 30189837
  2. Our results demonstrate that ADAM23 expression is likely involved in the progression of epithelial ovarian cancer PMID: 29921495
  3. ADAM23 regulates neuronal differentiation by triggering specific signaling pathways during human neural progenitor cells differentiation. PMID: 28828010
  4. these results support the existence of a second mechanism, alternative to inhibition of protein secretion, by which ADLTE-causing LGI1 mutations exert their loss-of-function effect extracellularly, and suggest that interactions of LGI1 with both ADAM22 and ADAM23 play an important role in the molecular mechanisms leading to utosomal dominant lateral temporal epilepsy PMID: 27760137
  5. Our data provide evidence that ADAM23 plays a role in suppression of cancer cell progression through interaction with aVb3 integrin, and suggest that downregulation of ADAM23 in SP cells may contribute toward providing a cancer stem cell phenotype PMID: 26800504
  6. High ADAM23 gene methylation is associated with gastric tumor aggressiveness. PMID: 25740824
  7. quantification of CXCL12 and ADAM23 methylation could be useful for the prediction of advanced stage of BC PMID: 25620615
  8. Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals. PMID: 24662834
  9. The expression level of ADAM23 is likely to be involved in the progression of non-small-cell lung carcinoma, and its downregulation is probably correlated with promoter methylation. PMID: 21429053
  10. a SP1 binding site (-202/-190) that binds SP1 at the proximal promoter of human ADAM23 gene was indentified. PMID: 20851106
  11. Together, these results indicate that ADAM23 down-regulation by methylation in brain tumors is a rare event and it may help explain why brain tumor metastases are rarely found elsewhere in the body. PMID: 15862898
  12. ADAM23 is frequently silenced in gastric cancers by homozygous deletion or aberrant promoter methylation. PMID: 16103878
  13. ADAM23 may be down-regulated by aberrant promoter hypermethylation during the progression of colorectal cancer. PMID: 19089928
  14. PrP(C) is a novel molecular partner for ADAM23 in the nervous systems. PMID: 19477226
  15. Functional role of ADAM23 during lung caner metastatic progression by negatively modulating alpha(v)beta(3) integrin activation. PMID: 19549921

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform Gamma]: Secreted.
Tissue Specificity
Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole.
Database Links

HGNC: 202

OMIM: 603710

KEGG: hsa:8745

STRING: 9606.ENSP00000264377

UniGene: Hs.370287

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1