Recombinant Human E3 ubiquitin-protein ligase RNF103(RNF103)

Code CSB-CF019815HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O00237
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYS GLPEKKDVRELVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWL VQVIANDRSPLVGKIHWEKMVKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQT STSKGKVMLKEYSGRKIEVEHIFKWITAHAASRIKTIYNAEHLKEEWNKSDQYWLKIYLF ANLDQPPAFFSALSIKFTGRVEFIFVNVENWDNKSYMTDIGIYNMPSYILRTPEGIYRYG NHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATIKRFVVLISTL GTYNSLLIISWLPVLGFLQLPYLDSFYEYSLKLLRYSNTTTLASWVRADWMFYSSHPALF LSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVES DWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSEEEMSEGSQDTENDSE SENTDTLSSEKEVFEDKQSVLHNSPGTASHCDAEACSCANKYCQTSPCERKGRSYGSYNT NEDMEPDWLTWPADMLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCP VCRWPSYKKKQPYAQHQPLSNDVPS
Source in vitro E.coli expression system
Gene Names RNF103
Protein Names Recommended name: E3 ubiquitin-protein ligase RNF103 EC= 6.3.2.- Alternative name(s): KF-1 Short name= hKF-1 RING finger protein 103 Zinc finger protein 103 homolog Short name= Zfp-103
Expression Region 1-685
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as an E2-dependent E3 ubiquitin-protein ligase, probably involved in the ER-associated protein degradation pathway.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Tissue Specificity Highly expressed in the normal cerebellum but not in the cerebral cortex.
Database Links

HGNC: 12859

OMIM: 602507

KEGG: hsa:7844

STRING: 9606.ENSP00000237455

UniGene: Hs.469199

Related Products

RNF103 Antibodies

RNF103 Antibodies for Human

RNF103 Antibodies for Homo sapiens (Human)

RNF103 Proteins

RNF103 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.