Recombinant Human Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)

Code CSB-CF007694HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O75356
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH
Source in vitro E.coli expression system
Gene Names ENTPD5
Protein Names Recommended name: Ectonucleoside triphosphate diphosphohydrolase 5 Short name= NTPDase 5 EC= 3.6.1.6 Alternative name(s): CD39 antigen-like 4 ER-UDPase Guanosine-diphosphatase ENTPD5 Short name= GDPase ENTPD5 EC= 3.6.1.42 Nucleoside
Expression Region 1-428
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. The nucleotide hydrolyzing preference is GDP > IDP > UDP, but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling.
Subcellular Location Endoplasmic reticulum, Secreted
Protein Families GDA1/CD39 NTPase family
Tissue Specificity Expressed in adult liver, kidney, prostate, testis and colon. Much weaker expression in other tissues.
Database Links

HGNC: 3367

OMIM: 603162

KEGG: hsa:957

STRING: 9606.ENSP00000335246

UniGene: Hs.655070

Related Products

ENTPD5 Antibodies

ENTPD5 Antibodies for Human

ENTPD5 Antibodies for Homo sapiens (Human)

ENTPD5 Proteins

ENTPD5 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.