Recombinant Human Epithelial membrane protein 3 (EMP3)

Code CSB-CF007650HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
EMP3
Uniprot No.
Alternative Names
EMP3; YMP; Epithelial membrane protein 3; EMP-3; Hematopoietic neural membrane protein 1; HNMP-1; Protein YMP
Species
Homo sapiens (Human)
Expression Region
1-163
Target Protein Sequence
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSEN GWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAI HAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probably involved in cell proliferation and cell-cell interactions.
Gene References into Functions
  1. This study identified and validated a three-gene (EMP3, GSX2 and EMILIN3) prognostic signature in Lower-Grade Gliomas. PMID: 29794476
  2. High EMP3 expression is associated with high grade glioma. PMID: 27527869
  3. epithelial membrane protein 3 is a downstream effector of TWIST1/2 in inducing epithelial-to-mesenchymal transition in gastric cancer. Epithelial membrane protein 3 upregulation might be associated with gastric cancer metastasis and is a potential indicator of unfavorable overall survival and progression-free survival in gastric cancer patients PMID: 28718375
  4. Independent validation with glioma patients tissue (n = 70) and normal brain tissue (n = 19) found PPIC, EMP3 and CHI3L1 were up-regulated in glioma tissue. Survival value validation showed that the three genes correlated with patient survival by Kaplan-Meir analysis, including grades, age and therapy. PMID: 27801851
  5. The study provided a new insight into EMP3, suggesting that EMP3 enhances malignancy of hepatocellular carcinoma cells PMID: 26472188
  6. EMP3 functions as an oncogene and is regulated by microRNA-765 in primary breast carcinoma. PMID: 26398721
  7. The aim of this study was to investigate the EMP3 promoter hypermethylation status in a series of 229 astrocytic and oligodendroglial tumors and in 16 glioblastoma cell lines. PMID: 24083241
  8. Decreased expression of EMP3 by promoter methylation is associated by lung cancer PMID: 23920144
  9. LOH 19q determines the complete loss of EMP3 function, as the conserved allele is frequently hypermethylated, and this may represent the molecular basis of the higher risk of relapse in this subgroup of grade II oligodendroglioma patients. PMID: 22992787
  10. The promoter methylation and mRNA expressions of EMP3 and PCDH-gamma-A11 are closely related with the malignant development of glioma. PMID: 20388442
  11. EMP3 overexpression is associated with oligodendroglial tumors PMID: 17187361
  12. Oligodendroglial and astrocytic gliomas show EMP3 hypermethylation and aberrant expression. Primary and secondary glioblastomas have distinct genetic profiles and also differ in their epigenetic aberrations. PMID: 17610521
  13. Loss of EMP3 is associated with esophageal squamous cell carcinoma. PMID: 18823699
  14. Epithelial membrane protein 3 overexpression in breast carcinomas was significantly related to histological grade III , lymph node metastasis , and strong Her-2 expression. PMID: 19270820

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
PMP-22/EMP/MP20 family
Database Links

HGNC: 3335

OMIM: 602335

KEGG: hsa:2014

STRING: 9606.ENSP00000270221

UniGene: Hs.9999

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×