Recombinant Human Galanin receptor type 2(GALR2)

Code CSB-CF009224HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O43603
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA
Source in vitro E.coli expression system
Gene Names GALR2
Protein Names Recommended name: Galanin receptor type 2 Short name= GAL2-R Short name= GALR-2
Expression Region 1-387
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the hormone galanin and GALP. Receptor for the hormone spexin-1
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed abundantly within the central nervous system in both hypothalamus and hippocampus. In peripheral tissues, the strongest expression was observed in heart, kidney, liver, and small intestine.
Database Links

HGNC: 4133

OMIM: 603691

KEGG: hsa:8811

STRING: 9606.ENSP00000329684

UniGene: Hs.666366

Related Products

GALR2 Antibodies

GALR2 Antibodies for Homo sapiens (Human)

GALR2 Proteins

GALR2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.