Recombinant Human Glycophorin-B (GYPB)-VLPs

Code CSB-MP010075HU
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GYPB
Uniprot No.
Research Area
Immunology
Alternative Names
GYPB; GPB; Glycophorin-B; PAS-3; SS-active sialoglycoprotein; Sialoglycoprotein delta; CD antigen CD235b
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
20-91aa
Target Protein Sequence
LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein is a minor sialoglycoprotein in erythrocyte membranes.
Gene References into Functions
  1. through bioinformatic analysis, identified extensive variation in GYPB transcript levels in individuals from Benin, suggesting selection from malaria pressure; collective data suggest that the GPA and GPB receptors are of greater importance than the GPC receptor, supporting a hierarchy of erythrocyte receptor usage in P. falciparum PMID: 28760933
  2. A novel GYPB mutation (c.270+5G>A) accounting for the S-s-U+(var) phenotype was identified. PMID: 24738877
  3. Substitution of GPB with Gp.Mur significantly reduced the expression of Rh antigen and RhAG on the Mi.III(+/+) erythrocyte membrane PMID: 21883272
  4. an increased susceptibility to infection by this parasite is associated with the glycophorin B S+ variant in Brazilian Amazons PMID: 21283638
  5. Indochina I strain of P. falciparum is not dependent on glycophorin B to invade erythrocytse through a trypsin-resistant pathway as are the strains 3D7, HB3, and Dd2. PMID: 14638759
  6. The S-s-U+var phenotype arises from changes in or around GYPB exon 5. PMID: 14641872
  7. Alternative to conventional tube technique for mass screening for MNS hybrids, especially when specific antisera are not available. PMID: 17561857
  8. Immunoblotting showed the presence of monomer and dimer forms of a GP(A-B) hybrid and an absence of GPA and GPB. Sequencing of DNA and PCR-RFLP using the restriction enzyme RsaI confirmed the presence of a hybrid GYP(AB). PMID: 18284304
  9. The erythrocyte-binding domain, region 2 of EBL-1, bound glycophorin B(+) but PMID: 19279206
  10. This study reports for the first time the molecular mechanisms responsible for the S-s- phenotype in a population of African Brazilians and provides new information about the frequency and molecular bases of the GYPB*S silent gene in this population. PMID: 19856717

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Glycophorin-A family
Database Links

HGNC: 4703

OMIM: 111740

KEGG: hsa:2994

STRING: 9606.ENSP00000427690

UniGene: Hs.654368

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*