Recombinant Human HERV-K_16p3.3 provirus ancestral Env polyprotein

Code CSB-CF882131HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NX77
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence FIFTLIAVLAGLLAVTATAATAGVAIRSSVQTAHYVEACQKNSSRLWNSQAQIDQKLANQ INDLRQSVTWLGDRVMNLQHRMQLQCDWNTSDYCITPYAYNQDQHSWENVSRHLKAWDDN LTLDISQLKEQIFEASQAHLSTVPGSHIFEGITKQLPDFNPFKWLKPVRGSLLLLALLIL VCLCCLLLVCRCL
Source in vitro E.coli expression system
Gene Names ERVK13-1
Protein Names Recommended name: HERV-K_16p3.3 provirus ancestral Env polyprotein Alternative name(s): Envelope polyprotein Cleaved into the following 2 chains: 1. Surface protein Short name= 2. SU 3. Transmembrane protein Short name= 4. TM
Expression Region 290-482
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution (By similarity).
Subcellular Location Virion, SUBCELLULAR LOCATION: Transmembrane protein: Cell membrane, Single-pass membrane protein
Protein Families Beta type-B retroviral envelope protein family, HERV class-II K(HML-4) env subfamily
Tissue Specificity Primary culture of CD34+, lung, thymus, ileal mucosa, small intestine, and testis.
Database Links

HGNC: 27548

UniGene: Hs.406976

Related Products

ERVK13-1 Proteins

ERVK13-1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.