Recombinant Human Integral membrane protein GPR137(GPR137)

Code CSB-CF856990HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96N19
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLYGHKRLSYQT VFLALCLLWAALRTTLFSFYFRDTPRANRLGPLPFWLLYCCPVCLQFFTLTLMNLYFAQV VFKAKVKRRPEMSRGLLAVRGAFVGASLLFLLVNVLCAVLSHRRRAQPWALLLVRVLVSD SLFVICALSLAACLCLVARRAPSTSIYLEAKGTSVCQAAAMGGAMVLLYASRACYNLTAL ALAPQSRLDTFDYDWYNVSDQADLVNDLGNKGYLVFGLILFVWELLPTTLLVGFFRVHRP PQDLSTSHILNGQVFASRSYFFDRAGHCEDEGCSWEHSRGESTRCQDQAATTTVSTPPHR RDPPPSPTEYPGPSPPHPRPLCQVCLPLLAQDPGGRGYPLLWPAPCCSCHSELVPSP
Source in vitro E.coli expression system
Gene Names GPR137
Protein Names Recommended name: Integral membrane protein GPR137 Alternative name(s): Transmembrane 7 superfamily member 1-like 1 protein
Expression Region 1-417
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families GPR137 family
Database Links

HGNC: 24300

KEGG: hsa:56834

STRING: 9606.ENSP00000411827

UniGene: Hs.523763

Related Products

GPR137 Antibodies

GPR137 Antibodies for Homo sapiens (Human)

GPR137 Proteins

GPR137 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.