Recombinant Human Killer cell immunoglobulin-like receptor 2DL2(KIR2DL2)

Code CSB-CF012353HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43627
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP
Source in vitro E.coli expression system
Gene Names KIR2DL2
Protein Names Recommended name: Killer cell immunoglobulin-like receptor 2DL2 Alternative name(s): CD158 antigen-like family member B1 MHC class I NK cell receptor Natural killer-associated transcript 6 Short name= NKAT-6 p58 natural killer cell receptor c
Expression Region 22-348
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Database Links

HGNC: 6330

OMIM: 604937

KEGG: hsa:3803

UniGene: Hs.743949

Pathway Cellular senescence
Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

KIR2DL2 Antibodies

KIR2DL2 Antibodies for Homo sapiens (Human)

KIR2DL2 Antibodies for Human

KIR2DL2 Proteins

KIR2DL2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.