Recombinant Human MARVEL domain-containing protein 1 (MARVELD1)

Code CSB-CF861128HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MARVELD1
Uniprot No.
Alternative Names
MARVELD1; MRVLDC1; MARVEL domain-containing protein 1
Species
Homo sapiens (Human)
Expression Region
1-173
Target Protein Sequence
MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHF ALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQM QRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration.
Gene References into Functions
  1. MARVELD1 substantially inhibits nonsense-mediated RNA decay by decreasing the pioneer round of translation but not steady-state translation, and is an important component of the molecular machinery containing UPF1 and Y14. MARVELD1 promotes the dissociation of SMG1 from UPF1, resulting in the repression of serine phosphorylation of UPF1, and subsequently blocks the recruitment of SMG5. PMID: 23826386
  2. Study demonstrates that MARVELD1-mediated balance of integrin beta1 and beta4 regulates cell surface ultrastructure and epithelial-mesenchymal transition phenotype of non-small cell lung cancer (NSCLC). PMID: 26509557
  3. MARVELD1 silencing is an appealing diagnostic biomarker for lung cancer. PMID: 25520033
  4. Importin-beta1 mediates the non-classical nucleocytoplasmic transport of MARVELD1. PMID: 26107903
  5. MARVELD1 plays a role in pre-mRNA processing of integrin beta1. PMID: 24055813
  6. Our findings suggest that MARVELD1 is a tumor suppressor by negatively regulating proliferation, tumor growth and chemosensitivity of HCC cells via increasing p53 and p16 in vitro and in vivo. PMID: 22320884
  7. MARVELD1 protein is located in nucleus instead of cell membrane in several different tumors, in males and in females. PMID: 19364627

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton. Nucleus.
Tissue Specificity
Widely expressed in normal tissues. Down-regulated in multiple primary tumors.
Database Links

HGNC: 28674

KEGG: hsa:83742

STRING: 9606.ENSP00000441365

UniGene: Hs.744073

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×