Recombinant Human Membrane progestin receptor gamma(PAQR5)

Code CSB-CF889141HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NXK6
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFW FFAWRFVTALYMTDIKNDSYSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDY GAVNLFSLGSAIAYSAYTFPDALMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRL CKVIRVLAFAYPYTWDSLPIFYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPE RLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAIL LCIIFSLSNIIYFSAALYRIPKPELHKKET
Source in vitro E.coli expression system
Gene Names PAQR5
Protein Names Recommended name: Membrane progestin receptor gamma Short name= mPR gamma Alternative name(s): Progestin and adipoQ receptor family member 5 Progestin and adipoQ receptor family member V
Expression Region 1-330
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Tissue Specificity Expressed in the brain, lung, kidney, colon, adrenal and lung.
Database Links

HGNC: 29645

OMIM: 607781

KEGG: hsa:54852

STRING: 9606.ENSP00000343877

UniGene: Hs.591096

Related Products

PAQR5 Antibodies

PAQR5 Antibodies for Homo sapiens (Human)

PAQR5 Antibodies for Human

PAQR5 Proteins

PAQR5 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.