Recombinant Human Membrane-spanning 4-domains subfamily A member 7(MS4A7)

Code CSB-CF875636HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9GZW8
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLIS SLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTS NAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVS LTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Source in vitro E.coli expression system
Gene Names MS4A7
Protein Names Recommended name: Membrane-spanning 4-domains subfamily A member 7 Alternative name(s): CD20 antigen-like 4 CD20/FC-epsilon-RI-beta family member 4 Four-span transmembrane protein 2
Expression Region 1-240
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in signal transduction as a component of a multimeric receptor complex.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families MS4A family
Tissue Specificity Ubiquitous expression in normal tissues. Expression is more elevated in adult liver, lung, spleen, and heart than in their fetal counterparts, and is higher in normal tissues than in the cancerous tissue or cell lines. Low levels of expression were detect
Database Links

HGNC: 13378

OMIM: 606502

KEGG: hsa:58475

STRING: 9606.ENSP00000300184

UniGene: Hs.530735

Related Products

MS4A7 Antibodies

MS4A7 Antibodies for Homo sapiens (Human)

MS4A7 Antibodies for Human

MS4A7 Proteins

MS4A7 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.