Recombinant Human Metalloreductase STEAP4 (STEAP4)

Code CSB-CF731557HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
STEAP4
Uniprot No.
Alternative Names
STEAP4; STAMP2; TNFAIP9; Metalloreductase STEAP4; Six-transmembrane epithelial antigen of prostate 4; SixTransMembrane protein of prostate 2; Tumor necrosis factor, alpha-induced protein 9
Species
Homo sapiens (Human)
Expression Region
1-459
Target Protein Sequence
MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPS GAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEY LAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQ GSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAI SIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGF AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFV LLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAY VLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Integral membrane protein that functions as NADPH-dependent ferric-chelate reductase, using NADPH from one side of the membrane to reduce a Fe(3+) chelate that is bound on the other side of the membrane. Mediates sequential transmembrane electron transfer from NADPH to FAD and onto heme, and finally to the Fe(3+) chelate. Can also reduce Cu(2+) to Cu(1+). Plays a role in systemic metabolic homeostasis, integrating inflammatory and metabolic responses. Associated with obesity and insulin-resistance. Involved in inflammatory arthritis, through the regulation of inflammatory cytokines. Inhibits anchorage-independent cell proliferation.
Gene References into Functions
  1. These findings suggest that increased STEAP4 mRNA expression is associated with inflammatory stimuli, whereas lower STEAP4 expression is associated with obesity in human islets. PMID: 28405880
  2. STEAP4 plays role in metal homeostasis is critical to the maintenance of cellular homeostasis , and in preventing the onset of metabolic disease. [review] PMID: 28576871
  3. a down regulation of STEAP4 and up-regulation of HIF-1alpha are observed in morbidly obese patients PMID: 27058639
  4. The expression of TNFAIP9 significantly decreased in the adipose tissue of obese children, and its levels are closely related to blood lipid level, insulin resistance, and obesity. PMID: 27706555
  5. the expression of STEAP4 was significantly downregulated in the adipose tissue of obese children. PMID: 27808366
  6. Some SNPs of the STEAP4 gene altered the risk of developing a metabolic syndrome in the Han Chinese population. PMID: 26510124
  7. These data suggest that STAMP2 is required for prostate cancer progression and thus may serve as a novel therapeutic target. PMID: 25680860
  8. may interact with mitochondria [review] PMID: 24643198
  9. Our results show increased mRNA expression of STEAP4 and NGAL in human visceral adipose tissue in obese patients. PMID: 23179203
  10. Our findings revealed that STAMP2 gene polymorphisms are likely to significantly contribute to the risk of MetS in male Han Chinese population. PMID: 23953178
  11. three polymorphisms (rs8122, rs1981529 and rs34741656) of STAMP2 gene may be not related with type 2 diabetes mellitus in Xinjiang Uygur population PMID: 23134829
  12. STEAP4 was highly induced in human adipose cells differentiated in the presence of 1,25D. PMID: 23553608
  13. STAMP2 antagonizes HBx-mediated hepatocyte dysfunction, thereby protecting hepatocytes from hepatitis B virus gene expression. PMID: 23095254
  14. STEAP4 genetic variations are likely to be associated with obesity-related insulin resistance in Uygur Chinese general population. PMID: 21718614
  15. STEAP4 is expressed on monocytes and neutrophils in peripheral blood of patients with rheumatoid arthritis. PMID: 22244520
  16. STEAP4 might potentially suppress the pathogenesis of TNFalpha-induced arthritis such as rheumatoid arthritis. PMID: 21633911
  17. an association of the common variation rs1981529 (Gly75Asp, 224A/G) in the STEAP4 gene with obesity in Uygur general population PMID: 21933608
  18. Decreased STAMP2 expression (mRNA and protein) might reflect visceral adipose dysfunction in subjects with obesity and type 2 diabetes. PMID: 21849520
  19. The knockdown of STEAP4 inhibits insulin-stimulated glucose transport and GLUT4 translocation via the attenuated phosphorylation of Akt, independent of the effects of EEA1. PMID: 21468601
  20. There was no association of the three polymorphisms (rs8122, rs1981529 and rs34741656) in the STAMP2 gene with essential hypertension in Xinjiang Uygur population. PMID: 21287513
  21. STEAP 4 genetic polymorphisms may be associated with metabolic syndrome risk in Chinese Uygur population. PMID: 21287516
  22. Fourteen novel and six known single nucleotide polymorphisms (SNPs) including 2 nonsynonymous SNPs in the STEAP4 gene were identified. SNPs rs8122 and rs1981529 were significantly associated with the metabolic syndrome phenotype in females. PMID: 21044749
  23. common polymorphisms of STAMP2 are unlikely to significantly contribute to the risk of the metabolic syndrome in the general population PMID: 20382686
  24. Results demonstrate that STEAP4 does not influence human adipocyte differentiation, but it participates in regulating the insulin sensitivity of human adipocytes. PMID: 20127040
  25. Human WAT STAMP2 associates with obesity and insulin resistance independently of adiponectin. PMID: 18381574
  26. Down-regulation of STEAP4 is associated with obesity in humans. PMID: 18430367
  27. TIARP/STAMP2 is highly upregulated in 3T3-L1 cells and hMSC-Ad by IL-1beta and might, therefore, modulate proinflammatory and insulin resistance-inducing effects of IL-1beta. PMID: 19289123
  28. STEAP4 associates with focal adhesion kinase (FAK) and regulate the activity of FAK through Y397 phosphorylation. PMID: 19787193

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.
Protein Families
STEAP family
Tissue Specificity
Ubiquitous. Highly expressed in adipose tissue. Expressed in placenta, lung, heart and prostate. Detected at lower levels in liver, skeletal muscle, pancreas, testis and small intestine. Highly expressed in joints of patients with rheumatoid arthritis and
Database Links

HGNC: 21923

OMIM: 611098

KEGG: hsa:79689

STRING: 9606.ENSP00000369419

UniGene: Hs.521008

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×