Recombinant Human Microsomal glutathione S-transferase 1 (MGST1)

Code CSB-CF013791HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MGST1
Uniprot No.
Alternative Names
MGST1; GST12; MGST; Microsomal glutathione S-transferase 1; Microsomal GST-1; Microsomal GST-I
Species
Homo sapiens (Human)
Expression Region
2-155
Target Protein Sequence
VDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKK YLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAY LTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity.
Gene References into Functions
  1. High MGST1 expression is associated with Bendamustine-resistance in Mantle Cell Lymphoma. PMID: 29695404
  2. Significant association for germline variations only in the COX pathway (specifically in the antioxidant microsomal glutathione S-transferase 1 [MGST1] gene), with risk for Barrett's esophagus and the combined outcome of Barrett's esophagus and esophageal adenocarcinoma was found. PMID: 29713984
  3. This study provides the most comprehensive evaluation of inflammation-related germline variation in relation to risk of BE/OA and suggests that variants in MGST1 influence disease susceptibility. PMID: 27486097
  4. The MSGT1 displays a preexisting dynamic equilibrium between high- and low-activity forms. PMID: 28558199
  5. possibly marked variations in NB mitochondrial homeostasis, they also imply that the results of these earlier studies using NB cells are not transferable to other tumor and cell types that express MGST1 at high concentrations. PMID: 24486338
  6. Differential expression of SOD2, ALDH1A1, and MGST1 genes in the anterior lens capsules of patients with pseudoexfoliation syndrome suggest that diseased tissue appears to respond to the previously reported oxidative stress. PMID: 23805041
  7. The results suggest that MGST1 gene polymorphisms as one of environment gene may contribute to colorectal cancer risk in younger ages. PMID: 23314968
  8. MGST1 protects cells (and mitochondria) by both conjugation and glutathione peroxidase functions. A new protective mechanism against cisplatin is also indicated PMID: 20727966
  9. Polymorphisms in microsomal glutathione s transferase is associated with laryngeal cancer PMID: 12359356
  10. The results indicate that Sp1 is the protein mediating the basal transcription of MGST1 PMID: 12818425
  11. Genes encoding KU70, MGST1 and BIK show age-related mRNA expression levels in hematopoietic stem cells. PMID: 17714764
  12. As an addition to the high-density SNP (single-nucleotide polymorphism) maps of 12 glutathione S-transferase and related genes reported earlier, a SNP map of the microsomal glutathione S-transferase 1 (MGST1) gene is provided. PMID: 11587073

Show More

Hide All

Subcellular Location
Microsome. Mitochondrion outer membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
MAPEG family
Tissue Specificity
Highly expressed in liver.
Database Links

HGNC: 7061

OMIM: 138330

KEGG: hsa:4257

STRING: 9606.ENSP00000010404

UniGene: Hs.389700

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1