Recombinant Human Mitochondrial inner membrane protease subunit 2 (IMMP2L)

Code CSB-CF822306HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
IMMP2L
Uniprot No.
Alternative Names
IMMP2L; Mitochondrial inner membrane protease subunit 2; IMP2-like protein
Species
Homo sapiens (Human)
Expression Region
1-175
Target Protein Sequence
MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.
Gene References into Functions
  1. While the IMMP2L deletions carried non-recurrent breakpoints, in contrast to previous reports, meta-analysis found no evidence of association (P > 0.05) between IMMP2L deletions and ASD. We also observed common exonic deletions impacting IMMP2L in a separate control (5,971 samples) cohort where subjects were screened for psychiatric conditions. PMID: 29152845
  2. data would indicate that deletions involving the IMMP2L gene may contribute to the development of a subgroup of cognitive/behavioral disorders PMID: 29788020
  3. Deficiency of IMMP2L in cells cultured under hypoxia and high glucose, exacerbated neuronal death. PMID: 28316022
  4. Chromosomal breakpoints involved the IMMP2L gene in 7q31 is associated with Diffuse Large B-Cell Lymphomas. PMID: 27356265
  5. IMMP2L transcription requires Topoisomerase I in human primary astrocytes PMID: 27932244
  6. genomic rearrangements affecting IMMP2L may be one of the predisposing factors involved in Tourette syndrome and overlapping neurodevelopmental disorders. PMID: 24549057
  7. AUTS1/AUTS5 linkage to immp2l-dock4 may be involved in autism susceptibility PMID: 19401682

Show More

Hide All

Involvement in disease
Gilles de la Tourette syndrome (GTS)
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Protein Families
Peptidase S26 family, IMP2 subfamily
Tissue Specificity
Expressed in all tissues tested except adult liver and lung.
Database Links

HGNC: 14598

OMIM: 137580

KEGG: hsa:83943

STRING: 9606.ENSP00000329553

UniGene: Hs.655722

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1